Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eznF_

Fold library idPDB HeaderMoleculeTitle
c6eznF_3.30PDB header: membrane proteinChain: F: PDB Molecule: dolichyl-diphosphooligosaccharide--protein


Added to library: Sat Jan 20 10:39:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SCVLSVFQTILKLVIFVAIFGAAISSRLFAVIKFESIIHEFDPWFNYRATKYLVNNSFYKFLNWFDDRTW
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

STTTTTTTTT




SSSS
S


TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YPLGRVTGGTLYPGLMTTSAFIWHALRNWLGLPIDIRNVCVLFAPLFSGVTAWATYEFTKEIKDASAGLL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTT


SSSS

TTTSS



BTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence AAGFIAIVPGYISRSVAGSYDNEAIAITLLMVTFMFWIKAQKTGSIMHATCAALFYFYMVSAWGGYVFIT
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)
SSS
SB

SSSTTT

TT
TTGGGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence NLIPLHVFLLILMGRYSSKLYSAYTTWYAIGTVASMQIPFVGFLPIRSNDHMAALGVFGLIQIVAFGDFV
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) GTTT


TT
STTSSS
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KGQISTAKFKVIMQPVSWPAFFFDTHFLIWLFPAGVFLLFLDLKDEHVFVIAYSVLCSYFAGVMVRLMLT
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTS
TTT




SSSTTTTTT

SS
STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LTPVICVSAAVALSKIFDIYLDFKIKPAALLAKLIVSGSFIFYLYLFVFHSTWVTRTAYSSPSVVLPSQT
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) S





S


SSS




 .........430.........440.........450.........460.........470.........480.........490
Sequence KLALIDDFREAYYWLRMNSDEDSKVAAWWDYGYQIGGMADRTTLVDNNTWNNTHIAIVGKAMASPEEKSY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)





SS
TT



GGGT

S

SS
S
SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence EILKEHDVDYVLVIFGGLIGFGGDDINKFLWMIRISEGIWPEEIKERDFYTAEGEYRVDARASETMRNSL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT



TTTT
S
STTTSSTTSTTTS
TTSSS
SSS



STTS
TS
 .........570.........580.........590.........600.........610.........620.........630
Sequence LYKMSYKDFPQLFNGGQATDRVRQQMITPLDVPPLDYFDEVFTSENWMVRIYQLKKDDAQGRTLRDVGEL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) STT
TTSSBTTB
TTT


TTSS


SS
TTS




TTS

 .........640.........650
Sequence TRSSTKTRRSIKRPELGLRV
Predicted secondary structure













SS confidence



















Known secondary structure (DSSP) SSS

TT













Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D