Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eznA_

Fold library idPDB HeaderMoleculeTitle
c6eznA_3.30PDB header: membrane proteinChain: A: PDB Molecule: dolichyl-diphosphooligosaccharide--protein


Added to library: Sat Jan 20 10:29:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YEPPATWENVDYKRTIDVSNAYISETIEITIKNIASEPATEYFTAFESGIFSKVSFFSAYFTNEATFLNS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



SS

SSSS


SSS




TTTTTS
SSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence QLLAEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGMSEEQHLLWETNRLPLSAYDTKKASFT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




SS


SS
S


SSSB

TTS

SS


SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence LIGSSSFEEYHPPNDESLLGKANGNSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSS
SS

S
SSS

TT



S


S


S

TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence STIQFEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGATDHYFTDLVGLVSTSHA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T
S
B
TT


S


S
SSBS


SS




SSSB


 .........290.........300.........310.........320.........330.........340.........350
Sequence ERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLHVSSGSDEKFVASIPILNGPPDTVYDNVELSVFLPEG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT

SS
B
TT
GGGT
SS
TTS



SSS

TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence AEIFDIDSPVPFTNVSIETQKSYFDLNKGHVKLTFSYRNLISQVANGQVLIKYDYPKSSFFKKPLSIACY
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SS

S

TT

SS

STTT




T
 .........430........
Sequence IFTALMGVFVLKTLNMNV
Predicted secondary structure

SS confidence

















Known secondary structure (DSSP) TTS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D