Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ez8B_

Fold library idPDB HeaderMoleculeTitle
c6ez8B_4.00PDB header: protein bindingChain: B: PDB Molecule: factor viii intron 22 protein;


Added to library: Sat Feb 24 08:33:21 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NVAEAGEQFGQLGRELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCP
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
TTTTT

SSTTTTT
GGGSSSSSTTTSSTTTTTTTSS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence AAYGEPLQAAASALGAAVRLHLELGQPAAAAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAAL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) T

STTTTTTT
TTTTTTSTTTTTTTT
TTTTTTT
TTTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QALGEAASCQLLARDYTGALAVFTRMQRLAREHGSALGAFSDVLVRCEVSRVLLLLLLQPPPAKLLPEHA
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) STTTSSTTTT
TTTTTTTT


STTTTTTTSSSSTTTTTTTTS


SSS

TT
 .........220.........230.........240.........250.........260........
Sequence QTLEKYSLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTAEQNHLLHLVLQETI
Predicted secondary structure



SS confidence

























































Known secondary structure (DSSP) TT


TTTTT
TTSTTTS
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D