Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ez8A_

Fold library idPDB HeaderMoleculeTitle
c6ez8A_4.00PDB header: protein bindingChain: A: PDB Molecule: huntingtin;


Added to library: Sat Feb 24 08:34:14 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLP
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
TTTT


S
TTTTTSS
TTTTTTTTSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPK
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) T

TTTTTTGGGS
TTTTTTS


TTGGGTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence IMASFGNFANDNEIKVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVED
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SSTT

TTSS


TTTTTTSS
TTTTSSTTSSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence EHSTLLILGVLLTLRYLVPLLQVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)


TTTTTTTTTTGGG





TTTTTTTS

SSSTTTTTTTTTTTTTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence LTAVGGIGQLTARIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSST




S



TT
SSS
TTT

TTSS



TTTS
TTTTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence VALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLICSILSRSRFHVGDWMG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT
TTSTTSBS
SS


TTT
S


BTTGGGGTTSSSSTTTSSTTTTTTTTTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence TIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSSSYSELGLQLIIDVLTLRNSSYW
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTS




TTTTTT
SSTTTTTSSSSTTTTTTTSTTTTGGGGG
S
T
 .........500.........510.........520.........530.........540.........550.........560
Sequence LVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTTTTTTTTTTS

TTT
SSTTTTGGG

S


TTTTGGGG
S
TTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence RLVPKLFYKCDQGQADPVVAVARDQSSVYLKRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SGGG


S

SS

SSTTTTTTTT




TT


S




TTSSSTTTTTTTTTTS

S
 .........640.........650.........660.........670.........680.........690.........700
Sequence LTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SSSSSSTTTTTTS
TTTS
SSSS





STSSSGGG
STTTTTTSSTTTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence SAPKSLRVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPLGSFYHLPSYLRLHDVLKATHANYKV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT


TTT

TTTSSSSSSTTTT






SS
STTTGGGTTTTTSSTTTTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence TLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGT
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S




S

SSTTTTTTTTTTT

TTTSTTT

SSSSTTTTS

 .........850.........860.........870.........880.........890.........900.........910
Sequence PGLYHYCFMAPYTHFTQALADASLRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSD
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)

SSTTTTTTTTSS


TTTT


TTTTTSSTTTSSSTTTTT

S
TTSSS
 .........920.........930.........940.........950.........960.........970.........980
Sequence QVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYEIGIPKIIQLCDGIMASGRKAVTHAIPALQPI
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TTTTTT

S
GGGTTTTT


SSS





STTT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence VHDLFVLGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQM
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTTT

SSTTSTTT
TTTTT
S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence HIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVL
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)


STTTS
TTSSS
STTS


S

SSTTTTTTTSSSTTTS
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence SRIQELSFSPYLISCTVINRLRDGKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGT
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTTT

TTTT
TTTT



SSSTTTTSSS
TTTTS
STTSSTTTS
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence LLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDY
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SSSSTTSSS
SS

STTSS

TTTTTSTTT
SSSSSTTTTTT


T
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence RWWAEVQQTPLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHR
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTT




TTTTTTTTTTTSTT
TTTS
STTTTSTTT
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence NSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRR
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TTSTTTTTSTTTTTTSSS

GGGSSSSTTTGGG
S
TTTSSSTTTTT
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence VEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTDKDWYVHLVKSQCWTRSDS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SS
TTS
TSS


TTTGGGTSSS

S
 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence ALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLP
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
STTTS
SS
SSSSS

TTTTSSS

SS
 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence AVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) SS




SSSSSSS
GGGGGGGTTSS
TTTTTGGGG

TTSS

SGGGTT
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence ATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIHCVHFILEAVAVQPGE
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) STTTSS


SSTTTTTTSTTSGGGSTTTTTTS
SS
 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence QLLSNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
S



TTSSTT
SGGGSS
SSSTTTTTTTTSTTTTS
 .........1760.........1770.........1780.........1790.........1800.........1810.........1820
Sequence LGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLRTQINVLAVQAI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT





SSSS






GGGTTSTTT


SGGGTT

TTT
 .........1830.........1840.........1850.........1860.........1870.........1880.........1890
Sequence TSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TSSBSSSSS
TTT

B



SS


SSSSSTTTTTTTSS

SS

S

S


 .........1900.........1910.........1920.........1930.........1940.........1950.........1960
Sequence WDPVPSLTTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPGVDIHSCSQFLLELYSRWI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



B





B

TTTSTTTS
TTS
TT

S

S
SS
TTTS






TT
 .........1970.........1980.........1990.........2000.........2010.........2020.........2030
Sequence LTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKAVA
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)


GGGS


TTS
S

TTTS


 .........2040.........2050.........2060.........2070.........2080.........2090.........2100
Sequence EPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT
S
TTTTSS


TTTGGGSSSS
STTT
STT
 .........2110.........2120.........2130.........2140.........2150.........2160.........2170
Sequence VMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTT

TTS
TTTS
TTTS
TSTTS
T
 .........2180.........2190.........2200.........2210.........2220.........2230.........2240
Sequence KLSVDRVNVHSPHRAMAALGLMLTCMYTGESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFP
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTTSS


SS
TTTS
 .........2250.........2260.........2270.........2280.........2290.........2300.........2310
Sequence PQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCF
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTS
TT
S
STTTTSTTTTTTTTS


 .........2320.........2330.........2340.........2350...
Sequence FVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQ
Predicted secondary structure











SS confidence










































Known secondary structure (DSSP) SS
SSSSGGGTT

S


TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D