Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eyuA_

Fold library idPDB HeaderMoleculeTitle
c6eyuA_2.50PDB header: membrane proteinChain: A: PDB Molecule: bacteriorhodopsin;


Added to library: Sat Dec 16 08:26:05 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MVYEAITAGGFGSQPFILAYIITAMISGLLFLYLPRKLDVPQKFGIIHFFIVVWSGLMYTNFLNQSFLSD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
STT
TTT

S

TTGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence YAWYMDWMVSTPLILLALGLTAFHGADTKRYDLLGALLGAEFTLVITGLLAQAQGSITPYYVGVLLLLGV
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) GTT
S


T
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VYLLAKPFREIAEESSDGLARAYKILAGYIGIFFLSYPTVWYISGIDALPGSLNILDPTQTSIALVVLPF
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTTS
B

TTS

S


B
 .........220.........230..
Sequence FCKQVYGFLDMYLIHKAELEHH
Predicted secondary structure

SS confidence





















Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D