Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ey5B_

Fold library idPDB HeaderMoleculeTitle
c6ey5B_2.85PDB header: protein transportChain: B: PDB Molecule: t9ss component cytoplasmic membrane protein porm;


Added to library: Sat Feb 10 08:26:56 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RVNSITAQVIPQSQIVMSGDTYKANIVLSSVDTTQRPDVFVNGKLLSPENMGLFTATAGAPGTYPVKGYI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


S
SS

TTS



TT


TT

GGGTT






SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence EMMGNDGVKIRRDFESEYFVTEPMASVAPTMMNVLYAGIDNPINIAVPGVAQQNVSATINNGTLTRRGNL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTS



SS



GGG
TTS




TTS
TTT
SSSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence WIARPTKVGSEAIISVTAQSGGRTIQMAKTTLRVRALPDPLPYIEYKDVQGNTKRFKGGRLGKREILAAG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


TTS


SSS








SSS


S
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GIKAALDDDLLEVNYTVVKFQLVFYDSMGNSIPEVSDGASFSERQKRQIQNLGKGKRFYVTEVIARGPDG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S

S
SSS


B
TT


BTTB

TT
TT

TT
 .........290...
Sequence IERKIPAIEVIVN
Predicted secondary structure



SS confidence












Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D