Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ey4A_

Fold library idPDB HeaderMoleculeTitle
c6ey4A_2.00PDB header: protein transportChain: A: PDB Molecule: gldm;


Added to library: Sat Feb 10 08:27:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LYFQSFGLMNEKFEAANTSSVTTNESLLTSLDQKAAEAKGEFAKAAETAHKVQAASKEFYDYIGTLKTQA
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP)

S
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence VKGFEVDKETGKMPYEAMDRGDNIDDWFTGDGYTKKGNEIIAKIEKYKSDIKAALGTDKKYAGIISEVEK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTT



TTT



GGG



GGGGGGTT
S
S
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence KFDVSDVKNKEGIKEKYLAYHFKGFPAIASAAKLSAWQNDVKKTEADVYNSALGKAAVAAASYSNYQAIV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T

S

TTS

TT


GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence VLDKNAYFQGEKVTGKVVLGRYDENTKPTSFQGPGQIVNGQAVISLTAGGVGEQDINGQFTFLEDGKNIP
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
S


TTS




TT


SSSTT




SSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LKFSGKYVVVPRPNSATISADKMNVVYRGVVNPISVSFAGVDANKIVASAPGLSSAGKPGKYNMSPGQGT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)










GGG
TTS



TTS
GGG
TTTT


SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence EATISVTGTLPNGDKVTDKKTFRIKGIPGPTGTIRGEMGVVKGPKSNLEIATIGAKLLDFDFEVGLDVVG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTS





TTB
S
T
B
TT

S

 .........430.........440.........450.........460.........470.........480...
Sequence FNMKIAGQPTVVVTGNKMNAQCKSVLARAGKGDQVTISEIKTKLVGAGSYLLPRTAPVIYEIQ
Predicted secondary structure

























SS confidence






























































Known secondary structure (DSSP)
TTS

SSB

GGG

TT
SSSS

B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D