Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6evuA_

Fold library idPDB HeaderMoleculeTitle
c6evuA_1.60PDB header: cell adhesionChain: A: PDB Molecule: prgb;


Added to library: Sat May 19 08:30:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPYEKEVAEYNKHKNENSYVNEAISKNLVFDQSVVTKDTKISSIKGGKFIKATDFNKVNAGDSKDIFTKL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TT


SS







SGGG

TT
SS

T


TT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RKDMGGKATGNFQNSFVKEANLGSNGGYAVLLEKNKPVTVTYTGLNASYLGRKITKAEFVYELQSSPSQS
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SS

TT


B
TTTT

GGG
TT
BTTB
S

TT

STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GTLNAVFSNDPIITAFIGTNRVNGKDVKTRLTIKFFDASGKEVLPDKDSPFAYALSSLNSSLTNKGGHAE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SSTTT




SS

TTS



TTS




B


SS


 .........220.........230.........240.........250.........260.........270.........280
Sequence FVSDFGANNAFKYINGSYVKKQADGKFYSPEDIDYGTGPSGLKNSDWDAVGHKNAYFGSGVGLANGRISF
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)


TT
TT
S

TTS

SS
SSBS
STT

BGGGT
STT
TTGGGG
SSS
 .........290.........300.........310...
Sequence SFGMTTKGKSNVPVSSAQWFAFSTNLNAQSVKP
Predicted secondary structure


















SS confidence
































Known secondary structure (DSSP)
TT
S

TT
S


S

S
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D