Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eu6A_

Fold library idPDB HeaderMoleculeTitle
c6eu6A_1.98PDB header: membrane proteinChain: A: PDB Molecule: ammonium transporter;


Added to library: Sat Jan 27 08:30:21 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MENIQININHLWVIMAACMVFLMQLGFTSYETGFSQSKNAISIALRNLVDTLISSLVFFSVGFGFMFGKS
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP)
S
GGGTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YMGLIGIDLFFANDLALHPNTLSYSFFFFQMVFASTAATILTGAIAERSGFIPNIAGTAFIVAIIYPIFG
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTT
S
GGGTTGGGSS
TTSTTTB
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence HWAWGNLFSPDQTGWLKELGFIDFAGATVVHSIGGWFAMAAAIMVGPRIDKYNPDGSSNRIGLHNVPLAT
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTSSSTT


TT


SS
TTTT


TTSB
TTS
B






 .........220.........230.........240.........250.........260.........270.........280
Sequence LGTFFLWFGWFGFNGGSLLRVSVNIGLVILNTNMAAASAGVSALIFIYATRKRIEAGSLFTAILAGLVAI
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TT
S
STSS

 .........290.........300.........310.........320.........330.........340.........350
Sequence TASSNMVTPVSAVAIGLITGILAIIAEGFIEKTLKIDDPVSAIAVHGVGGVIGTLCVAIFAQKSYLLAEN
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTTTTS
TS



TT
S
GGG


TT
 .........360.........370.........380.........390.........400.....
Sequence GSRMHQLGIQALGVIVAFSWSFGLGMLFFLCLKKVKRLRVTPEEEKRGLNVAEAA
Predicted secondary structure













SS confidence






















































Known secondary structure (DSSP)

S
SB


S

STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D