Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eu0V_

Fold library idPDB HeaderMoleculeTitle
c6eu0V_4.00PDB header: transcriptionChain: V: PDB Molecule: transcription factor tfiiib component b'';


Added to library: Sat Jan 20 11:02:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KKVRDGESAKYFIDEENFTMAELCKPNFPIGQISENFEKSKMAKKAKLEKRRHLRELRMRARQEFKPLHS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

S




SSSS

SSSS

SS

TTT


S


S

TTTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LTKEEQEEEEEKRKEERDKLESDRKAHTAIQLKGTMAIDEETMVVDRHKNAENEYKEKVDENPFANLYNY
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)







SSS




SS
SSSS

TT


SS

TT










 .........150.........160.........170.........180.........190.........200.........210
Sequence GSYGRGSYTDPWTVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEKKRPILIELALRSKLP
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SS
SS







S
S
STTS

S


 .........220.........230.........240.........250.........260.........270...
Sequence PNFDEYCCEIKKNIGTVADFNEKLIELQNEHKHHMKEIEEAKNTAKEEDQTAQRLNDANLNKK
Predicted secondary structure




SS confidence






























































Known secondary structure (DSSP) SSSS







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D