Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6etzA_

Fold library idPDB HeaderMoleculeTitle
c6etzA_1.80PDB header: hydrolaseChain: A: PDB Molecule: beta-galactosidase;


Added to library: Sat Jan 13 08:39:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GRSLELGAADIQDLESFEAGRGALPARAYLQSDAPRLSLNGEWQFRLSPGSRVAPDDGWQLGEALNGFES
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)




S
T

S

SS







SS


SSTTTS

S
GGG
SS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LPVPSSWPMHGHGAPAYTNVQFPFAVEPPHVPEANPIGDHLVVFEAGPEFFPHALLRFDGIESAGTVWLN
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S

GGGGTSS

SSS
SS


TT


S



GGG
S
S
ST
 .........150.........160.........170.........180.........190.........200.........210
Sequence GVELGTTRGSRLAHEFDVSGILEQGENTLAVRVAQFSAASYVEDQDMWWLPGIFRDVTLQARPAAGIDDV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TSTTS

TTTS
SS

GGGGGB

S


S


TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence FVHAGYDHITGEGILKVEASRGGQAIDAVVRVPELALELAAGTEVRVPAVEPWSAEVPKLYEAAVSAAGE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TTT

TT


GGGTTT

S





SSS


TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence SVALQIGFRSIAIEDAQFKVNGRRILLRGVNRHEHHPRLGRVVPRDVVEAELRLMKQHNINAIRTSHYPP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



TTTT





BTTTBT


TT


TTS

 .........360.........370.........380.........390.........400.........410.........420
Sequence HPQFLALADQLGFYVVLECDLETHGFESAGWAQNPSDDPQWEDALVDRMRRTVERDKNHASVVMWSLGNE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTT

S
B
GGGGGGTTTT
GGG
GGGTT
TT

SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence AGTGRNLAAMSRWTKDRDPSRPIHYEGDWSSEHVDVYSRMYASQAETALIGQGIEPALNDAALDARRRAM
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




TTS

SS
TT
TT
SSS

TT
S


SSTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence PFVLCEYVHAMGNGPGGMSEYQALFEKYPRLMGGFVWEWLEHGITVSTADGVDHYGYGGDFGEEVHDGNF
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
S


SS




TTS
SB



TTS

TTTT

SS

GGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence VTDGLVDADRRPRPGLLDFKKVIEPLRIDVARDWTGFTLRNGQDFADTSAFSFRYEVEADGGALDGGTVD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) G


SB
TT

B
T
S
TTSS

SS

STTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence VAPVAPQSETVVELPGSVAALAAGLSDGRPAVLTVRAVLGADSAWADAGHEVAWGQSVREPGAPVPPAPV
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)




TT


S
TT

SS

SSS
TT











 .........710.........720.........730.........740.........750.........760.........770
Sequence EPVQVQDSELTLGPVVFSRATGMPTSIGGVPVEKLGLTLWWAPTDNDLGREWGGADERPLATQWKDAGLN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

SSTTTTT
STT





TGGGS


SSS



TTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence RLHTRLLGISANPGQDGGETLTVRTRVSAADKQYGVLVDYTWSTDGETVGLRTQVRRDGTWVNRGFEVEW
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
STT
TT


SSSSS

TT


 .........850.........860.........870.........880.........890.........900.........910
Sequence ARIGLEFVLGEETELVSWFGQGPHQSYPDTGQGARAGWFSLPLAKMDVEYVRPQECGARSGSRSAALQLG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SSS


SS
B
TT

TT
GGGGS


SS

S


T
 .........920.........930.........940.........950.........960.........970.........980
Sequence GRTLEICGDPFALTVRPYSQDVLDAAAHRPDLKADGRTYLYVDHALRGVGTAACGPGVLEQYRLKPRDAD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TSS

SSGGG



S





TTSS

S
GGG





 .........
Sequence FILTLKVRS
Predicted secondary structure
SS confidence








Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D