Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6etzA_

Fold library idPDB HeaderMoleculeTitle
c6etzA_1.80PDB header: hydrolaseChain: A: PDB Molecule: beta-galactosidase;


Added to library: Sat Jan 13 08:39:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GRSLELGAADIQDLESFEAGRGALPARAYLQSDAPRLSLNGEWQFRLSPGSRVAPDDGWQLGEALNGFES
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)




S
T

S

SS







SS


SSTTTS

S
GGG
SS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LPVPSSWPMHGHGAPAYTNVQFPFAVEPPHVPEANPIGDHLVVFEAGPEFFPHALLRFDGIESAGTVWLN
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S

GGGGTSS

SSS
SS


TT


S



GGG
S
S
ST
 .........150.........160.........170.........180.........190.........200.........210
Sequence GVELGTTRGSRLAHEFDVSGILEQGENTLAVRVAQFSAASYVEDQDMWWLPGIFRDVTLQARPAAGIDDV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TSTTS

TTTS
SS

GGGGGB

S


S


TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence FVHAGYDHITGEGILKVEASRGGQAIDAVVRVPELALELAAGTEVRVPAVEPWSAEVPKLYEAAVSAAGE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TTT

TT


GGGTTT

S





SSS


TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence SVALQIGFRSIAIEDAQFKVNGRRILLRGVNRHEHHPRLGRVVPRDVVEAELRLMKQHNINAIRTSHYPP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



TTTT





BTTTBT


TT


TTS

 .........360.........370.........380.........390.........400.........410.........420
Sequence HPQFLALADQLGFYVVLECDLETHGFESAGWAQNPSDDPQWEDALVDRMRRTVERDKNHASVVMWSLGNE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTT

S
B
GGGGGGTTTT
GGG
GGGTT
TT

SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence AGTGRNLAAMSRWTKDRDPSRPIHYEGDWSSEHVDVYSRMYASQAETALIGQGIEPALNDAALDARRRAM
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




TTS

SS
TT
TT
SSS

TT
S


SSTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence PFVLCEYVHAMGNGPGGMSEYQALFEKYPRLMGGFVWEWLEHGITVSTADGVDHYGYGGDFGEEVHDGNF
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
S


SS




TTS
SB



TTS

TTTT

SS

GGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence VTDGLVDADRRPRPGLLDFKKVIEPLRIDVARDWTGFTLRNGQDFADTSAFSFRYEVEADGGALDGGTVD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) G


SB
TT

B
T
S
TTSS

SS

STTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence VAPVAPQSETVVELPGSVAALAAGLSDGRPAVLTVRAVLGADSAWADAGHEVAWGQSVREPGAPVPPAPV
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)




TT


S
TT

SS

SSS
TT











 .........710.........720.........730.........740.........750.........760.........770
Sequence EPVQVQDSELTLGPVVFSRATGMPTSIGGVPVEKLGLTLWWAPTDNDLGREWGGADERPLATQWKDAGLN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

SSTTTTT
STT





TGGGS


SSS



TTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence RLHTRLLGISANPGQDGGETLTVRTRVSAADKQYGVLVDYTWSTDGETVGLRTQVRRDGTWVNRGFEVEW
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
STT
TT


SSSSS

TT


 .........850.........860.........870.........880.........890.........900.........910
Sequence ARIGLEFVLGEETELVSWFGQGPHQSYPDTGQGARAGWFSLPLAKMDVEYVRPQECGARSGSRSAALQLG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SSS


SS
B
TT

TT
GGGGS


SS

S


T
 .........920.........930.........940.........950.........960.........970.........980
Sequence GRTLEICGDPFALTVRPYSQDVLDAAAHRPDLKADGRTYLYVDHALRGVGTAACGPGVLEQYRLKPRDAD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TSS

SSGGG



S





TTSS

S
GGG





 .........
Sequence FILTLKVRS
Predicted secondary structure
SS confidence








Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D