Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6es9A_

Fold library idPDB HeaderMoleculeTitle
c6es9A_1.37PDB header: flavoproteinChain: A: PDB Molecule: acyl-coa dehydrogenase;


Added to library: Sat Jan 6 08:35:50 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MPADTPSALLALAGEALPELESLQSRATEALRALVAPAGKPQPALLEQHQHAAHALSWLTTYVESIRQLS
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

S
S
TTSS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GWAGRLAEAGNLGRIEALILQIGLGEYLGQIAGGIPMSQTEFARLSDLELDWQPGEAAAKLMRGNTAPAR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT



SSSS

GGGGT





T


 .........150.........160.........170.........180.........190.........200.........210
Sequence AELARLMQDNHGRATFGATGLDEDLEMIRDQFRRYAEERVIPNAHEWHLKDQLIPMEIIEELAELGVFGL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TS
TT
SSSS




TTTTTT



TTGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TIPEEFGGLGLSKASMVVVTEELSRGYIGVGSLGTRSEIAAELILCGGTEAQKAKWLPGLASGEILSTAV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TS
GGGTS




S
TSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FTEPNTGSDLGSLRTRAVRDGEDWVVTGNKTWITHAQRTHVMTLLARTDPETTDWRGLSMFLAEKEPGTD
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

BTTBSS
GGG


TTTTTT
S

TT

SGGG




S
 .........360.........370.........380.........390.........400.........410.........420
Sequence DDPFPTPGMTGGEIEVLGYRGMKEYELGFDGFRIKGENLLGGEPGRGFKQLMETFESARIQTAARAVGVA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSS

STT


SS

SS

GGGBTTSSTT
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence QSAAEIGMRYAVDRKQFGKSLIEFPRVADKLAMMAVEIMIARQLTYFSAWEKDHGRRCDLEAGMAKLLGA
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
TTGGGSTT


 .........500.........510.........520.........530.........540.....
Sequence RVAWAAADNALQIHGGNGFALEYAISRVLCDARILNIFEGAAEIQAQVIARRLLD
Predicted secondary structure









SS confidence






















































Known secondary structure (DSSP) GGGGGSTTSGGGTTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D