Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ercA_

Fold library idPDB HeaderMoleculeTitle
c6ercA_2.50PDB header: oxidoreductaseChain: A: PDB Molecule: peroxinectin a;


Added to library: Sat Dec 30 08:58:50 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SQEFRSYTGEGNNKQNPKQGSIFTPFIRLANPIKFNKNGFPNITNQPSRAISNIIFDQQTHIGSKEHLTD
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)





SSSTTSSSSSTTTT
SS
B
SS





TTS




S

T


S



TT
BB
 .........80.........90.........100.........110.........120.........130.........140
Sequence MFNMWGQFLIHNMALSKPEPNSWPIKVPKCDQYFDPACIGNKTMNYFRTRATEVPCDVGKTVVDEDGKCY
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TTT







TT
TTT
TT

TT




TTSSS

B
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EQINSLGSYIDGNVLYGNSEEICKNLRSLSGGEMKMTVTDVGDLPPKNVPGVPMDNDANLFPIDQLYSVG
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
S
SS
SS
SSB
SSTT
B

TT

BS
TT




SS

S
GGGSB

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence ERRGNENPGLLSIHTLLLRDHNRLARKFARLHPEWDDERVFQQSRSCIIEQIQKITYDEYLPTTLGSFPS
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) SGGGGS

TTS
TS



 .........290.........300.........310.........320.........330.........340.........350
Sequence YTGYDANVNAQVSNEFTTTAFRFGHSEVGPFMEYYSENGTRLQPLPIKFSYFNPHALNRGVEPLIRGLII
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)




TT




BTGGGG

S
TTS
GGGTTT
GGGGTT
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence NEEENIDIYMISDLRNFLFGKPGQGGLDLASRNLQRNRDHGIPPYNSLRRQLGLRPVQTWSDITSDPQIQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SB


SSS


SB
SSSTTS

B
T

BTT




S
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence NRLKNAYKSVDDIDSYVGGLAEDHMEGSCVGQTFYLIIYEQFFRTRAGDRFWYETPEMRMVNRECETTTF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SSGGGSBS
B
TT
SSBT
TT
TTSTTT




 .........500.........510.
Sequence AEVIKRTTSNIGYVQPNVFRK
Predicted secondary structure






SS confidence




















Known secondary structure (DSSP)
SS




S
TTB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D