Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ercA_

Fold library idPDB HeaderMoleculeTitle
c6ercA_2.50PDB header: oxidoreductaseChain: A: PDB Molecule: peroxinectin a;


Added to library: Sat Dec 30 08:58:50 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SQEFRSYTGEGNNKQNPKQGSIFTPFIRLANPIKFNKNGFPNITNQPSRAISNIIFDQQTHIGSKEHLTD
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)





SSSTTSSSSSTTTT
SS
B
SS





TTS




S

T


S



TT
BB
 .........80.........90.........100.........110.........120.........130.........140
Sequence MFNMWGQFLIHNMALSKPEPNSWPIKVPKCDQYFDPACIGNKTMNYFRTRATEVPCDVGKTVVDEDGKCY
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TTT







TT
TTT
TT

TT




TTSSS

B
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EQINSLGSYIDGNVLYGNSEEICKNLRSLSGGEMKMTVTDVGDLPPKNVPGVPMDNDANLFPIDQLYSVG
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
S
SS
SS
SSB
SSTT
B

TT

BS
TT




SS

S
GGGSB

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence ERRGNENPGLLSIHTLLLRDHNRLARKFARLHPEWDDERVFQQSRSCIIEQIQKITYDEYLPTTLGSFPS
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) SGGGGS

TTS
TS



 .........290.........300.........310.........320.........330.........340.........350
Sequence YTGYDANVNAQVSNEFTTTAFRFGHSEVGPFMEYYSENGTRLQPLPIKFSYFNPHALNRGVEPLIRGLII
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)




TT




BTGGGG

S
TTS
GGGTTT
GGGGTT
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence NEEENIDIYMISDLRNFLFGKPGQGGLDLASRNLQRNRDHGIPPYNSLRRQLGLRPVQTWSDITSDPQIQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SB


SSS


SB
SSSTTS

B
T

BTT




S
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence NRLKNAYKSVDDIDSYVGGLAEDHMEGSCVGQTFYLIIYEQFFRTRAGDRFWYETPEMRMVNRECETTTF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SSGGGSBS
B
TT
SSBT
TT
TTSTTT




 .........500.........510.
Sequence AEVIKRTTSNIGYVQPNVFRK
Predicted secondary structure






SS confidence




















Known secondary structure (DSSP)
SS




S
TTB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D