Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eqoB_

Fold library idPDB HeaderMoleculeTitle
c6eqoB_2.70PDB header: oxidoreductaseChain: B: PDB Molecule: acetyl-coenzyme a synthetase;


Added to library: Sat Oct 27 10:19:07 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ISDRDHFQRLREECRSDPGEFHGRLAKREICWLIENPAWAFYDDAAETWTGWDASSAAPITLDLPESFEP
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)






S



TTTTTTS





TTT

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence WERAFNDDDPPNWRWFEGGLTSTAFNEVDRHVLSGHGDEAAMIFEGDRWNMASEGGRGGPVDSEVISRRK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SS

STTT
T

TTTGGGS
S
SST
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLLESAKCALALKALGLEAGDRIALNMPSIPEQIYWTEGAKRMGIVYTPVFGGFSDKTLSDRIADAGARV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT

SS


SSTT


SSB
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence VVTADGSYRNAQMVPFKPSYTDPALDNFIAVPVAMELLGQALEVVAPEHAGLIRSEVAGLLDGEVTVERS
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP) STT
TTTTS
T



TT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence DVMRGVGKALTAIASGEAAGGAMTPRQAAQLRIAIASALVDSPPRVDAVVVVKHTAQPDLPWNEARDHWS
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) TS
SSS



T


S
S
SS

SS



TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence HDLTAAAGEELLKAARDAGFDVADEEALLALSDTEFVRAIWAGAPVLAVDAEYPNFIIYTSGSTGKPKGV
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TTT



STTS
S


TTS

SSSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence VHVHGGYASGVAATMPAAFGAEPGDVMYVVADPGWITGQSYQIAASLLSRVTTVITEGSPVFPHAGRFAS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) STTTS


TT



TTSTTTTT
SS
TTSSSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence IIERYGVNVFKAGVTFLKSVMQNPENLKDIQRYDLSSLKVATFCAEPVSPAVQAFAMEHITHRYINSYWA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T


STTSTTS

TT
S
SS


T
S

B

 .........570.........580.........590.........600.........610.........620.........630
Sequence TEHGGMVWTHFADADGFPLEADAHTYPLPWIMGDVWVEDADGSSNGPVEYERDTPWRVAEDGEKGEIVIA
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TTT
S
S

TT
SS



TT

B
TTS

SS



TT
SS






TT

S
 .........640.........650.........660.........670.........680.........690.........700
Sequence LPYPYLTRTIWGDVENFTVEHVGNLARVAGGWRGDEVRYADTYWRRWKGAWAYTQGDFAMRHPDGSFSLH
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S

TTS


BS

GGG

TT
TT

SSTTTSTT



TTS
 .........710.........720.........730.........740.........750.........760.........770
Sequence GRSDDVINVSGHRIGTEEIEGAILRDKALDPNSPVGNVIVIGAPHSQKGVTPIAFVTPVEGRRLTQDDKR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSSTT
TT

TTT
TT



 .........780.........790.........800.........810.........820.........830.........840
Sequence RLTDLVRTEKGAVAVPQDFIELSEFPETRSGKYMRRMVRAVVEGGEVLRNPESLDELARAVDGWKRRQSL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TBGGG

S
S


B
TTS
B
T




SS

 .........850.........860.........870.........880.........890.........900.........910
Sequence SDTQALFERYRFFTIQYNLVAPGKRVATVTVKNPPVNALNERALDELVIIAEHLARKDDVAAVVFTGSGT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

S
SS
TT

TTT

B

TTSSS
 .........920.........930.........940.........950.........960.........970.........980
Sequence ASFVAGADIRQMLEEVNSVEEAKALPDNAQLAFRTIEEMDKPCIAAIQGVALGGGMEFALACHYRVAEPK
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S

B
S

S
SS

STTTSS
TT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence ARFGQPEINLRLLPGYGGTQRLPRLLADGGGETGLRDALDLILGGRAIDADAALAVGAVDALADGSDNAL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


GGGGGT



SST


B
TS
S

TT

 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence SHAHAMVREFVRSGDDSALGKAFAARKTQTQSWHEPASIDLDAVLEDEFLQRILNQLEWAGRDKAGERAL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) GGGSTS

SS
TT
T
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence DAVRTGWTQGMTAGLECEAQRFAEAIIDPEGGKTGIQQFMDKQSPPLPVRRDGVWEDDQHEATKTALIEA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TTTTT







GGG


GGGT
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence GDLLPLGAPFYPGVTAIPPKQLAFGIARDPDTGAPRFGPPETHERELVVNTPKPGANEALIYLLSSEVNF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTB

TT



TTTS


SB
TTT

B









TTS
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence NDIWALTGIPVSPFDAHDEDVQITGSGGLALVAALGSELKEEGRLQVGDLVSVYSGTSELLSPLAGDDPM
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) T
SS
GGGG


S





S

TT




TTSGGGGT
GG
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence YAGFAIQGYETKTGSHAQFLTVQGPQLHRPPADLTLEQAGAYTLNLGTVARCLFTTLEIQAGKTAFVEGS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GSS
TTTSSS

SSBSGGG


TTS
TSSTTT


TT
TTT
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence ATGTGLDALKSSVRTGLAVTGLVSSEDRAEFVKSHGSVGAINRKDPEIADCFTPVPDDPDEARQWEADGE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TST
SSTTT
STTSTTTGGG
S


SSTT
 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence KLLDAYRETNGGKLADYVVSHAGERAFPRSFQLLAEGGRLAFYGASSGYHFSFMGKGGEARPDEMLARAN
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TTTT


S
TTTTS

TT
S

S



TT
 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence LRGGESVLLYYGPGSHELADEKGLEMVEAARLMKARMVIVTTSDGQREFLQSLGLEDAVEGIVSIEGLKR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TT
S
SSS
S

TT
SSTTS

TTT
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence RLSDFHWPDTLPRLPDARTDIENFKIGVRAYQQNTMKPFGTAVGKLLRSPGNPRGVPDLVIERAGQDTLG
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
TT



SS





TTT
T

SS
TT


S

TTS

 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence VSTSLVKPFGGRVIYAEEMAGRRYTFYAPQVWTRQRRIYMPSAEIFGTHLCNAYEVTMMNEMVAAGLLDV
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) S
TTT


S

TT
TTT

SS

S

TSS

 .........1760.........1770.........1780.........1790.........1800...
Sequence TEPTMVPWEGLPEAHQAMWDNRHSGATYVVNHALPAMGLTTKDELLEYWVAAQ
Predicted secondary structure



















SS confidence




















































Known secondary structure (DSSP)



GGGTT

SSS
SS
SSTT

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D