Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6epdM_

Fold library idPDB HeaderMoleculeTitle
c6epdM_15.40PDB header: hydrolaseChain: M: PDB Molecule: 26s proteasome regulatory subunit 6a;


Added to library: Sat Feb 10 08:49:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVI
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)

SSSS

SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETL
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)



TTTTTTS


SS
SSSS

SSSSS


SSS
GGG

TT
SSS




B
 .........150.........160.........170.........180.........190.........200.........210
Sequence PTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
S


SS






STTS
S
TT



S
SSTTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)




SSTTT
S

SSSSS
S
S


SST
 .........290.........300.........310.........320.........330.........340.........350
Sequence EVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSSSSSSSS
S
SSS

STTTS


S

SS
 .........360.........370.........380.........390.........400.........410.....
Sequence VSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA
Predicted secondary structure



















SS confidence
































































Known secondary structure (DSSP) SSSSTT

S

T
S



SSS


S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D