Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6epcJ_

Fold library idPDB HeaderMoleculeTitle
c6epcJ_12.30PDB header: hydrolaseChain: J: PDB Molecule: 26s proteasome regulatory subunit 8;


Added to library: Sat Feb 10 08:49:26 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQG
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)

S



S

SSSS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
SSSSSS


SSS
STT

SSTTTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence EKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)






S

T



SS
SSSST
 .........220.........230.........240.........250.........260.........270.........280
Sequence FIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SS
SS

SSS
SSS
ST
S


SSSS
SSSSSSS
SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence DGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT
SS


SSSSS

SSSS




S

TTS


SS

 .........360.........370.........380.........390.........400......
Sequence MPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Predicted secondary structure
















SS confidence























































Known secondary structure (DSSP)




T
SS

T

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D