Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eosB_

Fold library idPDB HeaderMoleculeTitle
c6eosB_3.10PDB header: hydrolaseChain: B: PDB Molecule: dipeptidyl peptidase 8;


Added to library: Sat Feb 10 08:40:52 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LEPFYVERYSWSQLKKLLADTRKAPHDFMFVKRNDPDGPHSDRIYYLAMENTLFYSEIPKTINRAAVLML
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)












B





SS
S


SS

SSS

B
 .........80.........90.........100.........110.........120.........130.........140
Sequence SWKPLLDLGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPD
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)






B


B

TTTTB
BTT
B
SSTT


SS








SS


SSSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence WIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWCPKAETTPSGG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) SSSSTTT







SSS



SSB

TS


B

S

B

TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVIDKELIQ
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


B
SSS

S
TTT



BTTS


B


SSSSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVMERQRLIESVPDSVTPL
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
STT
SSSS
TTS

GGG

SSS
SSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence IIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLYKITSILKESKYKRSSGGLPAPSDFKC
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
SS




S


B



STTSTTTSS




S

GGG
S


TTTTB
 .........430.........440.........450.........460.........470.........480.........490
Sequence PIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVSYVNPGEVTRLTDRGYSHSCC
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S

SSS
B

STT



TTTTBSSSBTTB

SSS




S
TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence ISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TTSS
SSS


B

SS
SS

B





S
TT




TTSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence YGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

SS

SS



TT



SSS
TTSTTTTT


TT
SSSG
 .........640.........650.........660.........670.........680.........690.........700
Sequence AFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAPVTLWIF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) GGTT
TTTT
TTT
TTT
SS



GGG
 .........710.........720.........730.........740.........750.........760.........770
Sequence YDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAHTSILLSFLVRAGKPYD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SB

GGGG
TTT

TTS
SSTTSTT
SSS
TT


 .........780.........790.........800.........810.
Sequence LQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKV
Predicted secondary structure


















SS confidence








































Known secondary structure (DSSP) TT

SS

STTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D