Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eorD_

Fold library idPDB HeaderMoleculeTitle
c6eorD_2.90PDB header: hydrolaseChain: D: PDB Molecule: dipeptidyl peptidase 9;


Added to library: Sat Feb 10 08:41:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PAARFQVQKHSWDGLRSIIHGSRKAPHDFQFVQKTDEGPHSHRLYYLGMPRENSLLYSEIPKLLLSWKQM
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTB




















B

B


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LDHFQATPHHGVYSREEELLRERKRLGVFGITSYDFHSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
S


S
GGG


TT

S
B


TTTTTT
SSTT


SS



 .........150.........160.........170.........180.........190.........200.........210
Sequence EIKTQCSGPRMDPKICPADPAFFSFINNSDLWVANIETGEERRLTFCHQVLDDPKSAGVATFVIQEEFDR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


S

S


SS
TTTTTTT




S



S

B


S

 .........220.........230.........240.........250.........260.........270.........280
Sequence FTGYWWCPTASWEGLKTLRILYEEVDESEVEVIHVPSPALEERKTDSYRYPRTGSKNPKIALKLAEFQTD
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

B
SS
B




TTS

S
GGGT


BTTS



 .........290.........300.........310.........320.........330.........340.........350
Sequence SQGKIVSTQEKELVQPFSSLFPKVEYIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQ
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TTS
SS
STT


TTSS

TTS

GGG

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence RLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPQSEDELCFLRANECKTGFCHLYKVTAVLKSQGYD
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SS
SS



SS













STTTSS








 .........430.........440.........450.........460.........470.........480.........490
Sequence WSEPFSPGEDEFKCPIKEEIALTSGEWEVLARHGSKIWVNEETKLVYFQGTKDTPLEHHLYVVSYEAAGE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) SSS




TTSSB




SSS
B

STT

TTTTTTSSS


 .........500.........510.........520.........530.........540.........550.........560
Sequence IVRLTTPGFSHSCSMSQNFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAADYVPPEIF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

S
TTS
TTSS
SSS

S
TTSGGG








 .........570.........580.........590.........600.........610.........620.........630
Sequence HFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TTS


SS

TT
B

STT



SSS

TTTTT

TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence SCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SSS
GGGTT
TTTSSS
T
TTT
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence AGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S



GGGSB

GGG
T
GGGGGGGS
SSSSSTT
SSS
T
 .........780.........790.........800.........810..
Sequence QLIRAGKPYQLQIYPNERHSIRCPESGEHYEVTLLHFLQEYL
Predicted secondary structure













SS confidence









































Known secondary structure (DSSP) TT


TT

SS

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D