Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eorD_

Fold library idPDB HeaderMoleculeTitle
c6eorD_2.90PDB header: hydrolaseChain: D: PDB Molecule: dipeptidyl peptidase 9;


Added to library: Sat Feb 10 08:41:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PAARFQVQKHSWDGLRSIIHGSRKAPHDFQFVQKTDEGPHSHRLYYLGMPRENSLLYSEIPKLLLSWKQM
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTB




















B

B


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LDHFQATPHHGVYSREEELLRERKRLGVFGITSYDFHSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
S


S
GGG


TT

S
B


TTTTTT
SSTT


SS



 .........150.........160.........170.........180.........190.........200.........210
Sequence EIKTQCSGPRMDPKICPADPAFFSFINNSDLWVANIETGEERRLTFCHQVLDDPKSAGVATFVIQEEFDR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


S

S


SS
TTTTTTT




S



S

B


S

 .........220.........230.........240.........250.........260.........270.........280
Sequence FTGYWWCPTASWEGLKTLRILYEEVDESEVEVIHVPSPALEERKTDSYRYPRTGSKNPKIALKLAEFQTD
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

B
SS
B




TTS

S
GGGT


BTTS



 .........290.........300.........310.........320.........330.........340.........350
Sequence SQGKIVSTQEKELVQPFSSLFPKVEYIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQ
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TTS
SS
STT


TTSS

TTS

GGG

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence RLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPQSEDELCFLRANECKTGFCHLYKVTAVLKSQGYD
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SS
SS



SS













STTTSS








 .........430.........440.........450.........460.........470.........480.........490
Sequence WSEPFSPGEDEFKCPIKEEIALTSGEWEVLARHGSKIWVNEETKLVYFQGTKDTPLEHHLYVVSYEAAGE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) SSS




TTSSB




SSS
B

STT

TTTTTTSSS


 .........500.........510.........520.........530.........540.........550.........560
Sequence IVRLTTPGFSHSCSMSQNFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAADYVPPEIF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

S
TTS
TTSS
SSS

S
TTSGGG








 .........570.........580.........590.........600.........610.........620.........630
Sequence HFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TTS


SS

TT
B

STT



SSS

TTTTT

TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence SCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SSS
GGGTT
TTTSSS
T
TTT
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence AGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S



GGGSB

GGG
T
GGGGGGGS
SSSSSTT
SSS
T
 .........780.........790.........800.........810..
Sequence QLIRAGKPYQLQIYPNERHSIRCPESGEHYEVTLLHFLQEYL
Predicted secondary structure













SS confidence









































Known secondary structure (DSSP) TT


TT

SS

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D