Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eoqC_

Fold library idPDB HeaderMoleculeTitle
c6eoqC_3.00PDB header: hydrolaseChain: C: PDB Molecule: dipeptidyl peptidase 9;


Added to library: Sat Feb 10 08:42:04 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PAARFQVQKHSWDGLRSIIHGSRAPHDFQFVQKTGPHSHRLYYLGMPENSLLYSEIPKKLLLSWKQMLIT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTB




















B






 .........80.........90.........100.........110.........120.........130.........140
Sequence SYDFHSESGLFLFQASNSLFHCRDVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLWVANIETG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

TTTT

TTS










S

S


SS
TTTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence EERRLTFCHQLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWGLKTLRILYEEVDESEVEVIHVPSPALE
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)












S


S



S
S







SSS

S
GG
 .........220.........230.........240.........250.........260.........270.........280
Sequence ERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSSLFPKVEYIARAGWTRDGKYAWA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) G



BTTS





TT



SS
STT


TTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence MFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPEDELC
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TTS

GGG

S
SS
SS



SS










S
 .........360.........370.........380.........390.........400.........410.........420
Sequence FLRANECKTGFCHLYKVTAVLKSQGYDWSEPFSPEFKCPIKEEIALTSGEWEVLARHGSKIWVNEETKLV
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) STTTSS








SSS





B




SSS
B

STT


TTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence YFQGTKDTPLEHHLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFVSHYSSVSTPPCVHVYKLSGPDDD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTSSS




S
SSSB


TTSSB
SSS

S
TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence PLHKQPRFWASMMEADYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT








TT



SS

TT
B


TT


SSSS

T
 .........570.........580.........590.........600.........610.........620.........630
Sequence IKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTTT


TT
SSS
GGGTT
TTTTSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence WSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLPNEPN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T
TTT
SS



GGGSB

TTT
T
GGG
GGGS
SSSS
 .........710.........720.........730.........740.........750.........760......
Sequence RLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRCPESGEHYEVTLLHFLQEYLH
Predicted secondary structure























SS confidence

































































Known secondary structure (DSSP) S
TT
SSS
TT


TT

SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D