Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eoqC_

Fold library idPDB HeaderMoleculeTitle
c6eoqC_3.00PDB header: hydrolaseChain: C: PDB Molecule: dipeptidyl peptidase 9;


Added to library: Sat Feb 10 08:42:04 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PAARFQVQKHSWDGLRSIIHGSRAPHDFQFVQKTGPHSHRLYYLGMPENSLLYSEIPKKLLLSWKQMLIT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTB




















B






 .........80.........90.........100.........110.........120.........130.........140
Sequence SYDFHSESGLFLFQASNSLFHCRDVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLWVANIETG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

TTTT

TTS










S

S


SS
TTTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence EERRLTFCHQLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWGLKTLRILYEEVDESEVEVIHVPSPALE
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)












S


S



S
S







SSS

S
GG
 .........220.........230.........240.........250.........260.........270.........280
Sequence ERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSSLFPKVEYIARAGWTRDGKYAWA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) G



BTTS





TT



SS
STT


TTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence MFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPEDELC
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TTS

GGG

S
SS
SS



SS










S
 .........360.........370.........380.........390.........400.........410.........420
Sequence FLRANECKTGFCHLYKVTAVLKSQGYDWSEPFSPEFKCPIKEEIALTSGEWEVLARHGSKIWVNEETKLV
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) STTTSS








SSS





B




SSS
B

STT


TTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence YFQGTKDTPLEHHLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFVSHYSSVSTPPCVHVYKLSGPDDD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTSSS




S
SSSB


TTSSB
SSS

S
TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence PLHKQPRFWASMMEADYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT








TT



SS

TT
B


TT


SSSS

T
 .........570.........580.........590.........600.........610.........620.........630
Sequence IKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTTT


TT
SSS
GGGTT
TTTTSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence WSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLPNEPN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T
TTT
SS



GGGSB

TTT
T
GGG
GGGS
SSSS
 .........710.........720.........730.........740.........750.........760......
Sequence RLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRCPESGEHYEVTLLHFLQEYLH
Predicted secondary structure























SS confidence

































































Known secondary structure (DSSP) S
TT
SSS
TT


TT

SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D