Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6enzA_

Fold library idPDB HeaderMoleculeTitle
c6enzA_3.00PDB header: lyaseChain: A: PDB Molecule: acidic amino acid decarboxylase gadl1;


Added to library: Sat Jan 6 08:23:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VDGVVLNGPQTDVKAGEKFVEEACRLIMEEVVLKATDVNEKVCEWQPPEQLRQLLDLEMRDTGESQDKLL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SS






TTTTTT
TTS
S









SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence KLCQDVIHFSVKTNHPRFFNQLYAGLDYYSLAARIITEALNPSIYTYEVSPVFLLVEEAVLKKMIECVGW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S

TTSTTSSS

S





S
TTT
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence KEGDGIFNPGGSVSNMCAMNLARYRHCPDIKEKGLSGLPRLILFTSAECHYSMKKAASFLGIGTQNVYFV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS
SS
TT
STTS

TTS
TTTS
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence ETDGRGKMIPEDLEKQIWQARQEGAVPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSAL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
B
TTS
B
TT
BS
SSS

B

T

TTGGGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence VSRKHRRLLHGIHRADSVAWNPHKMLMAGIQCSALLVKDKSDLLKKCYSAKATDKFYDVSYDTGDKSIQC
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) G
TTTGGGGTTGGGSS
T


SS
S

S







SS
GGG

TTTSS
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence SRRPDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLMEPEYTNVCFWYIPPSLREMEE
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S


SSSSS

SSS

GGGTTS
S
 .........430.........440.........450.........460.........470.........480.......
Sequence GPEFWRKLSLVAPAIKEKMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDSLGRDM
Predicted secondary structure















SS confidence


































































Known secondary structure (DSSP) STTTS
TT


TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D