Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6enzA_

Fold library idPDB HeaderMoleculeTitle
c6enzA_3.00PDB header: lyaseChain: A: PDB Molecule: acidic amino acid decarboxylase gadl1;


Added to library: Sat Jan 6 08:23:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VDGVVLNGPQTDVKAGEKFVEEACRLIMEEVVLKATDVNEKVCEWQPPEQLRQLLDLEMRDTGESQDKLL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SS






TTTTTT
TTS
S









SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence KLCQDVIHFSVKTNHPRFFNQLYAGLDYYSLAARIITEALNPSIYTYEVSPVFLLVEEAVLKKMIECVGW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S

TTSTTSSS

S





S
TTT
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence KEGDGIFNPGGSVSNMCAMNLARYRHCPDIKEKGLSGLPRLILFTSAECHYSMKKAASFLGIGTQNVYFV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS
SS
TT
STTS

TTS
TTTS
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence ETDGRGKMIPEDLEKQIWQARQEGAVPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSAL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
B
TTS
B
TT
BS
SSS

B

T

TTGGGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence VSRKHRRLLHGIHRADSVAWNPHKMLMAGIQCSALLVKDKSDLLKKCYSAKATDKFYDVSYDTGDKSIQC
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) G
TTTGGGGTTGGGSS
T


SS
S

S







SS
GGG

TTTSS
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence SRRPDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLMEPEYTNVCFWYIPPSLREMEE
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S


SSSSS

SSS

GGGTTS
S
 .........430.........440.........450.........460.........470.........480.......
Sequence GPEFWRKLSLVAPAIKEKMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDSLGRDM
Predicted secondary structure















SS confidence


































































Known secondary structure (DSSP) STTTS
TT


TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D