Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em8H_

Fold library idPDB HeaderMoleculeTitle
c6em8H_8.40PDB header: chaperoneChain: H: PDB Molecule: atp-dependent clp protease atp-binding subunit clpc;


Added to library: Sat Dec 30 08:56:15 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLDSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SS


TT
S


SS
STT
SS


B

TTSSTT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ETLKDKRVMSLDMGTVGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAASNILKPALARGELQCIGATT
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) S










STT




SSSS






SSTTT






B
 .........150.........160.........170.........180.........190.........200.........210
Sequence LDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYVSDRF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTSTTTSSSTTT







TTTTTTTTTSS




S

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEA
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TTS


TT
SSTTSSS




TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KNEWKNAQGMSTSLSEEDIAEVIAGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVRRA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) STT






SST




SSS

SSSTTTTTTSS
SS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence RAGLKDPKRGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPHDDGGQLT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS
SSSS





S
SSSSS
SSS


GGGSSSSGGGSS


S






SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence EKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQRGQDY
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T

S





TTS
TGGGTTTSTT
B





GGGTGGGGT



 .........500.........510.........520.........530.........540.........550.........560
Sequence ETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELKEIVTMMVNKLTNRLSEQNINIIVTDKAKDKIA
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SSSSS

STTT


SS





STTT








 .........570.........580.........590.........600..
Sequence EEGYDPEYGARPLIRAIQKTIEDNLSELILDGNQIEGKKVTV
Predicted secondary structure

















SS confidence









































Known secondary structure (DSSP) T

SSSTTSTTTSS

TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D