Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em8H_

Fold library idPDB HeaderMoleculeTitle
c6em8H_8.40PDB header: chaperoneChain: H: PDB Molecule: atp-dependent clp protease atp-binding subunit clpc;


Added to library: Sat Dec 30 08:56:15 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLDSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SS


TT
S


SS
STT
SS


B

TTSSTT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ETLKDKRVMSLDMGTVGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAASNILKPALARGELQCIGATT
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) S










STT




SSSS






SSTTT






B
 .........150.........160.........170.........180.........190.........200.........210
Sequence LDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYVSDRF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTSTTTSSSTTT







TTTTTTTTTSS




S

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEA
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TTS


TT
SSTTSSS




TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KNEWKNAQGMSTSLSEEDIAEVIAGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVRRA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) STT






SST




SSS

SSSTTTTTTSS
SS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence RAGLKDPKRGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPHDDGGQLT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS
SSSS





S
SSSSS
SSS


GGGSSSSGGGSS


S






SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence EKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQRGQDY
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T

S





TTS
TGGGTTTSTT
B





GGGTGGGGT



 .........500.........510.........520.........530.........540.........550.........560
Sequence ETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELKEIVTMMVNKLTNRLSEQNINIIVTDKAKDKIA
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SSSSS

STTT


SS





STTT








 .........570.........580.........590.........600..
Sequence EEGYDPEYGARPLIRAIQKTIEDNLSELILDGNQIEGKKVTV
Predicted secondary structure

















SS confidence









































Known secondary structure (DSSP) T

SSSTTSTTTSS

TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D