Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em8F_

Fold library idPDB HeaderMoleculeTitle
c6em8F_8.40PDB header: chaperoneChain: F: PDB Molecule: atp-dependent clp protease atp-binding subunit clpc;


Added to library: Sat Dec 30 08:53:14 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKVIEEVEKLIGYTPRA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


STTTTTTT
SS

S
SSS



STTTTTT




TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KKVIELSMDEARKLHHNFVGTEHILLGLNEGVAARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) STS
SS




S
B
SSS
B


TTS
SSS

S
SS


STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NNTLDSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)




TTST
S



STT
SSSB


S
TTSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence VPETLKDKRVMSLDMGTVGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAASNILKPALARGELQCIGA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SSSS
S
S
B






S
SSB
B

S







TTSSSTTSTT




B

 .........290.........300.........310.........320.........330.........340.........350
Sequence TTLDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYVSD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


SGGGT







TTSS




TTGGGT

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence RFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYE
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)

TS


S





S
 .........430.........440.........450.........460.........470.........480.........490
Sequence EAKNEWKNAQGMSTSLSEEDIAEVIAGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT



S

TTTT




TTT

SS
TTTSSSS

 .........500.........510.........520.........530.........540.........550.........560
Sequence RARAGLKDPKRGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPHDDGGQ
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SBTTB
TT



S

S
SSSTTTTTSSS
S






GGG

SSS








ST
 .........570.........580.........590.........600.........610.........620.........630
Sequence LTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQRGQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TS

SB


B
SGGGS
TTTTTT




SS




S
SB


B




STT


 .........640.........650.........660.........670.........680.........690.........700
Sequence DYETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELKEIVTMMVNKLTNRLSEQNINIIVTDKAKDK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
S
TTTTTS
S






SS









 .........710.........720.........730.........740....
Sequence IAEEGYDPEYGARPLIRAIQKTIEDNLSELILDGNQIEGKKVTV
Predicted secondary structure

















SS confidence











































Known secondary structure (DSSP) TT

TTTTTSTTTTSS
TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D