Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em8F_

Fold library idPDB HeaderMoleculeTitle
c6em8F_8.40PDB header: chaperoneChain: F: PDB Molecule: atp-dependent clp protease atp-binding subunit clpc;


Added to library: Sat Dec 30 08:53:14 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKVIEEVEKLIGYTPRA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


STTTTTTT
SS

S
SSS



STTTTTT




TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KKVIELSMDEARKLHHNFVGTEHILLGLNEGVAARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) STS
SS




S
B
SSS
B


TTS
SSS

S
SS


STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NNTLDSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)




TTST
S



STT
SSSB


S
TTSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence VPETLKDKRVMSLDMGTVGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAASNILKPALARGELQCIGA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SSSS
S
S
B






S
SSB
B

S







TTSSSTTSTT




B

 .........290.........300.........310.........320.........330.........340.........350
Sequence TTLDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYVSD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


SGGGT







TTSS




TTGGGT

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence RFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYE
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)

TS


S





S
 .........430.........440.........450.........460.........470.........480.........490
Sequence EAKNEWKNAQGMSTSLSEEDIAEVIAGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT



S

TTTT




TTT

SS
TTTSSSS

 .........500.........510.........520.........530.........540.........550.........560
Sequence RARAGLKDPKRGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPHDDGGQ
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SBTTB
TT



S

S
SSSTTTTTSSS
S






GGG

SSS








ST
 .........570.........580.........590.........600.........610.........620.........630
Sequence LTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQRGQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TS

SB


B
SGGGS
TTTTTT




SS




S
SB


B




STT


 .........640.........650.........660.........670.........680.........690.........700
Sequence DYETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELKEIVTMMVNKLTNRLSEQNINIIVTDKAKDK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
S
TTTTTS
S






SS









 .........710.........720.........730.........740....
Sequence IAEEGYDPEYGARPLIRAIQKTIEDNLSELILDGNQIEGKKVTV
Predicted secondary structure

















SS confidence











































Known secondary structure (DSSP) TT

TTTTTSTTTTSS
TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D