Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em8E_

Fold library idPDB HeaderMoleculeTitle
c6em8E_8.40PDB header: chaperoneChain: E: PDB Molecule: atp-dependent clp protease atp-binding subunit clpc;


Added to library: Sat Dec 30 08:42:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKVIEEVEKLITLHYTP
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)


STTTTTT

SSS
SSTT

SSS




SSTTTTS






T
 .........80.........90.........100.........110.........120.........130.........140
Sequence RAKKVIELSMDEARKLHHNFVGTEHILLGLNEGVAARVFANLDLNITKARAQVVKALGNPEMSNKNAQAS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTTTTTTTT

S

TT



S

SSS


S

SSS

TT

S
S



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KSNNTLDSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT




TTSB
TTTTGGGS
S


SS
TTTTTSSS

SSTTSSST
 .........220.........230.........240.........250.........260.........270.........280
Sequence NEVPETLKDKRVMSLDMGTVGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAASNILKPALARGELQCI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T


TTSSS

B







SSTTTSSS



S








SSSTS




 .........290.........300.........310.........320.........330.........340.........350
Sequence GATTLDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)



SSTTTTT






TT



S
 .........360.........370.........380.........390.........400.........410.........420
Sequence SDRFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SSS
SS



TTTSS





TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence YEEAKNEWKNAQGMSTSLSEEDIAEVIAGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKA
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTGGG


SS

SSS




TTT

SSSTTTTTTTS


 .........500.........510.........520.........530.........540.........550.........560
Sequence VRRARAGLKDPKRGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPHDDG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTS
SSSSS
S



S
S
S
TTT

GGGB



SSSSSSSGGGTTS








 .........570.........580.........590.........600.........610.........620.........630
Sequence GQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQR
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

SSSS





GGGS
TBTTB


SS




SSS







STT
 .........640.........650.........660....
Sequence GQDYETIRKTMLKELKNSFRPEFLNRVDDIIVFH
Predicted secondary structure












SS confidence

































Known secondary structure (DSSP)


TTTTS
TS
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D