Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5w_

Fold library idPDB HeaderMoleculeTitle
c6em5w_4.30PDB header: ribosomeChain: W: PDB Molecule: ribosome assembly factor mrt4;


Added to library: Sat Dec 30 08:50:12 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASKLCPVNSLIIGVDIVPMKPMPNVITFQS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

SSGGGGGTTTT


S
SSSTTTSTTTTTS
SS



SS



BTTB
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence DITTEDCRSKLRGYMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SSSSTTTTTTTSS







STTTTS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KDYNKLIWVFQQLFEKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRLLDPKEVFEELPDGYHETSILD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTSTT


SSS
SSS



SS

ST







 .........220.........230.........240.........250.........260.........270.........280
Sequence FVRTISMLGEMNKFTIDENDHEWKILKKLKQTTDEFRSCIEDLKVLGKKDFKMILRWRKIAREILSEEEK
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T


S

SSSSSSSS
SS
SSS




 .........290.........300.........310.........320.........330.........340.........350
Sequence NQTKKEKHSRDIDIATVEAMTLAHQLALGQKNKHDLVDEGFNRYTFRDTENLPDWFLEDEKEHSKINKPI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) STSS

STTT

T

SS
S


SSS
TTS






 .........360.........370.........380.........390.........400.........410.........420
Sequence TKEAAMAIKEKIKAMNARPIKKVAEAKARKRMRAVARLEKVTLVVASGRNKGLAGRPKGVKGKYKMVDGV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


GGGS
TS



STTSSS
SS

SS

SS
S
 .........430......
Sequence MKNEQRALRRIAKKHH
Predicted secondary structure


SS confidence















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D