Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5w_

Fold library idPDB HeaderMoleculeTitle
c6em5w_4.30PDB header: ribosomeChain: W: PDB Molecule: ribosome assembly factor mrt4;


Added to library: Sat Dec 30 08:50:12 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASKLCPVNSLIIGVDIVPMKPMPNVITFQS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

SSGGGGGTTTT


S
SSSTTTSTTTTTS
SS



SS



BTTB
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence DITTEDCRSKLRGYMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
SSSSTTTTTTTSS







STTTTS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KDYNKLIWVFQQLFEKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRLLDPKEVFEELPDGYHETSILD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTSTT


SSS
SSS



SS

ST







 .........220.........230.........240.........250.........260.........270.........280
Sequence FVRTISMLGEMNKFTIDENDHEWKILKKLKQTTDEFRSCIEDLKVLGKKDFKMILRWRKIAREILSEEEK
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T


S

SSSSSSSS
SS
SSS




 .........290.........300.........310.........320.........330.........340.........350
Sequence NQTKKEKHSRDIDIATVEAMTLAHQLALGQKNKHDLVDEGFNRYTFRDTENLPDWFLEDEKEHSKINKPI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) STSS

STTT

T

SS
S


SSS
TTS






 .........360.........370.........380.........390.........400.........410.........420
Sequence TKEAAMAIKEKIKAMNARPIKKVAEAKARKRMRAVARLEKVTLVVASGRNKGLAGRPKGVKGKYKMVDGV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


GGGS
TS



STTSSS
SS

SS

SS
S
 .........430......
Sequence MKNEQRALRRIAKKHH
Predicted secondary structure


SS confidence















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D