Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5v_

Fold library idPDB HeaderMoleculeTitle
c6em5v_4.30PDB header: ribosomeChain: V: PDB Molecule: 60s ribosomal protein l23-a;


Added to library: Sat Dec 30 08:24:34 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVRKRKMNRSSVGKATRRNKDKQRKINIQSNPIIAANWDYSLTMAQNYKKLGLRAKLQTPAGGKETEVVK
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

TTSSS






S




S
S

TTS



S
SS

SS



S
 .........80.........90.........100.........110.........120.........130
Sequence KLEELASRSQSEREEEWLEKLYKKHGDDYKKMFFDKKLNIYQQSEGDLKRRLLRWKKRNG
Predicted secondary structure




















SS confidence



























































Known secondary structure (DSSP)




TSS
S
TTT

S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D