Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5r_

Fold library idPDB HeaderMoleculeTitle
c6em5r_4.30PDB header: ribosomeChain: R: PDB Molecule: 60s ribosomal protein l19-a;


Added to library: Sat Dec 30 08:24:18 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PQNDYIERHIKQHGKRLDHEERKRKREARESHKISERAQKLTGWKGKQFAKKRYAEKVSMRKKIKAHEQS
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)

S
TT
S
SSSSS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KVKRMITKHTFVGEGFTRRPVKMERIIRPSALRQKKANVTHPELGVTVFLPILAVKKNPQSPMYTQLGVL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

B

S
B


TT
TT

SS
TT
B

GGGB


SSS


SS
STB
 .........150.........160.........170......
Sequence TKGTIIEVNVSELVWGKYAQVTNEPDRDGCVNAVLL
Predicted secondary structure


















SS confidence



































Known secondary structure (DSSP)
TT


S




S
S
TTTSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D