Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5p_

Fold library idPDB HeaderMoleculeTitle
c6em5p_4.30PDB header: ribosomeChain: P: PDB Molecule: 60s ribosomal protein l17-a;


Added to library: Sat Dec 30 09:04:21 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PSYLNSFSNEDWVSSLDVGDGSKHIISGSYDGIVRTWDLSGNVQKQYSGHSGPIRAVKYISNTRLVSAGN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


SS
TTTTSSS

SS




SS

SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DRTLRLWKTKNDGKTLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFWSTIYKEMTVVRRRAPLSLLES
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP) SSB










B
SSS

TTSTTSSSTTTSB




B
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence HTAPVEQVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGSSARHITL
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)
SS

SS
TTSSSTTTT
SS
TTTTSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HDPRTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTITREDKSGVNDKVFAVKWA
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)







SS



SS
SS
TTS

SSSSS



SS



S


 .........290........
Sequence EKVGIISAGQDKKIQINK
Predicted secondary structure








SS confidence

















Known secondary structure (DSSP) SSS
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D