Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5m_

Fold library idPDB HeaderMoleculeTitle
c6em5m_4.30PDB header: ribosomeChain: M: PDB Molecule: 60s ribosomal protein l14-a;


Added to library: Sat Dec 30 09:40:13 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YSKYADGSDRIIKPEINPVYDSDDSDAETQNTIGNIPLSAYDEMPHIGYDINGKRIMRPAKGSALDQLLD
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)

B
SSS
B











S
SS



SS


S

TTTTSSSS
TT







T
 .........80.........90.........100.........110.........120.........130.........140
Sequence SIELPEGWTGLLDKNSGSSLNLTKEELELISKIQRNEQTDDSINPYEPLIDWFTRHEEVMPLTAVPEPKR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTS

TT

SSB
SSSSSB



T


SS
SS
SS




TTTTS

SS
S





GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence RFVPSKNEAKRVMKIVRAIREGRIIPPKKLKEMKEKEKIENYQYDLWGDSTETNDHVMHLRAPKLPPPTN
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) GTS

TSS

SSS


S
S
S
SS



STTSTT










 .........220.........230.........240.........250.........260.........270.........280
Sequence EESYNPPEEYLLSPEEKEAWENTEYSERERNFIPQKYSALRKVPGYGESIRERFERSLDLYLAPRVRKNK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S

SS

TTSS

TTS
TTS
S
SS




SSSTT



STTTS






 .........290.........300.........310.........320.........330.........340.........350
Sequence LNIDPNSLIPELPSPKDLRPFPIRCSTIYAGHKGKVRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



GGGGS




GGGG






SS

SSS

TTS
SSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence TTLIDDEENPDYHIECIEWNPDANNGILAVAVGENIHLIVPPIFGYDIENNGKTKIEDGFAQWNKPSQKQ
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

SSTT
TT



STT


TT

SSS
SGGG




 .........430.........440.........450.........460.........470.........480.........490
Sequence LEKDICITISCKKTVKKLSWHRKGDYFVTVQPDSGNTSVLIHQVSKHLTQSPFKKSKGIIMDAKFHPFKP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT
SS



SSSS
TT
GGG
TTTT


S


S

SSSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence QLFVCSQRYVRIYDLSQQILVKKLLPGARWLSKIDIHPRGDNLIASSFDKRVLWHDLDLASTPYKTLRYH
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SS
SSS
S

SSS

TTSSTTS
TTT
SS
S


 .........570.........580.........590.........600.........610.........620.........630
Sequence EKAVRSVNFHKKLPLFSSAADDGTIHVFHATVYDDMMKNPMIVPLKKLTGHKVINSLGVLDAIWHPREAW
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SS

SSSSTTS


SSS








SSS


SSSS
 .........640.....
Sequence LFSAGADNTARLWTT
Predicted secondary structure




SS confidence














Known secondary structure (DSSP) SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D