Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5b_

Fold library idPDB HeaderMoleculeTitle
c6em5b_4.30PDB header: ribosomeChain: B: PDB Molecule: 60s ribosomal protein l3;


Added to library: Sat Dec 30 08:33:40 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MQLSWKDIPTVAPANDLLDIVLNRTQRKTPTVIRPGFKITRIRAFYMRKVKYTGEGFVEKFEDILKGFPN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S









SSSS




TTS
S

 .........80.........90.........100.........110.........120.........130.........140
Sequence INDVHPFHRDLMDTLYEKNHYKISLAAISRAKSLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATIV
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) GGGS
S
TT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KKLRDPLAYLEQVRQHIGRLPSIDPNTRTLLICGYPNVGKSSFLRCITKSDVDVQPYAFTTKSLYVGHFD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTTTT




TTSSTTSSTTSS





SSTT


S

 .........220.........230.........240.........250.........260.........270.........280
Sequence YKYLRFQAIDTPGILMNNIEMQSIYAIAHLRSCVLYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSS







SS



SSGGGS
TTTTTTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence INERAQLLESVKEVPGVEIMTSSCQLEENVMEVRNKACEKLLASRTPFIPESVKNLKKYDPEDPNRRKLA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

TTGGGTTGGGSSS



TTSSS






S




TT
SSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence RDIEAENGGAGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEIAAKLQALEEEEEKLENEGFY
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S

SSS



STTSS

S
GGG
S




TT

SSTTT

 .
Sequence N
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D