Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5b_

Fold library idPDB HeaderMoleculeTitle
c6em5b_4.30PDB header: ribosomeChain: B: PDB Molecule: 60s ribosomal protein l3;


Added to library: Sat Dec 30 08:33:40 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MQLSWKDIPTVAPANDLLDIVLNRTQRKTPTVIRPGFKITRIRAFYMRKVKYTGEGFVEKFEDILKGFPN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S









SSSS




TTS
S

 .........80.........90.........100.........110.........120.........130.........140
Sequence INDVHPFHRDLMDTLYEKNHYKISLAAISRAKSLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATIV
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) GGGS
S
TT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KKLRDPLAYLEQVRQHIGRLPSIDPNTRTLLICGYPNVGKSSFLRCITKSDVDVQPYAFTTKSLYVGHFD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTTTT




TTSSTTSSTTSS





SSTT


S

 .........220.........230.........240.........250.........260.........270.........280
Sequence YKYLRFQAIDTPGILMNNIEMQSIYAIAHLRSCVLYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSS







SS



SSGGGS
TTTTTTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence INERAQLLESVKEVPGVEIMTSSCQLEENVMEVRNKACEKLLASRTPFIPESVKNLKKYDPEDPNRRKLA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

TTGGGTTGGGSSS



TTSSS






S




TT
SSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence RDIEAENGGAGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEIAAKLQALEEEEEKLENEGFY
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S

SSS



STTSS

S
GGG
S




TT

SSTTT

 .
Sequence N
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D