Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5I_

Fold library idPDB HeaderMoleculeTitle
c6em5I_4.30PDB header: ribosomeChain: I: PDB Molecule: nucleolar complex-associated protein 3;


Added to library: Sat Dec 30 08:47:51 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EKILQLKEDIADLVTKVMENTAALGRLCKMVESKNPNTCKFSMLALVPVFKSIIPGYRIRPLEVSKLRNF
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)




SSS
TTTTS

SS









S
 .........80.........90.........100.........110.........120.........130.........140
Sequence EQALVYNYKNYVGRLQSLSKTPSNAAPIQVSLGILATQAAKELISTASHFNFRTDIFTLLLRRICKPRIS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T

SSS
TT

SSS

S
S

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence TDPTSIQIIQTFETLLNEDEEGSISFEILRIFNKILKTRNFNIEESVLNMLLSLDVLHDYDKKKDRVHLS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
S
SSSTTS


ST
TTT





SS




 .........220.........230.........240.........250.........260.........270.........280
Sequence KKQRKARKEMQQIEEEMRNAEQAVSAEERERNQSEILKIVFTIYLNILKNNAKTLIGSVLEGLTKFGNMA
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)

TTTSSSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence NFDLLGDFLEVMKELISDTEFDAEVRKALLCIVSAFSLISNTQYMKLSKFVDGLYALLPYICLDADIELS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SSTGGG

T

S



TTT
STT


 .........360.........370.........380.........390.........400.........410.........420
Sequence YRSLRLADPLNNEIIKPSVNVSTKAELLLKALDHVFFRSKSGTKERATAFTKRLYMCISHTPEKTSIAIL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SS




S
TTTS

TTS
SSSTSS



TTTGGG

 .........430.........440.........450.
Sequence KFIDKLMNRYPEIAATLWDNALLEKHYCPVV
Predicted secondary structure










SS confidence






























Known secondary structure (DSSP)
S



SS
STTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D