Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em5I_

Fold library idPDB HeaderMoleculeTitle
c6em5I_4.30PDB header: ribosomeChain: I: PDB Molecule: nucleolar complex-associated protein 3;


Added to library: Sat Dec 30 08:47:51 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EKILQLKEDIADLVTKVMENTAALGRLCKMVESKNPNTCKFSMLALVPVFKSIIPGYRIRPLEVSKLRNF
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)




SSS
TTTTS

SS









S
 .........80.........90.........100.........110.........120.........130.........140
Sequence EQALVYNYKNYVGRLQSLSKTPSNAAPIQVSLGILATQAAKELISTASHFNFRTDIFTLLLRRICKPRIS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T

SSS
TT

SSS

S
S

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence TDPTSIQIIQTFETLLNEDEEGSISFEILRIFNKILKTRNFNIEESVLNMLLSLDVLHDYDKKKDRVHLS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
S
SSSTTS


ST
TTT





SS




 .........220.........230.........240.........250.........260.........270.........280
Sequence KKQRKARKEMQQIEEEMRNAEQAVSAEERERNQSEILKIVFTIYLNILKNNAKTLIGSVLEGLTKFGNMA
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)

TTTSSSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence NFDLLGDFLEVMKELISDTEFDAEVRKALLCIVSAFSLISNTQYMKLSKFVDGLYALLPYICLDADIELS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SSTGGG

T

S



TTT
STT


 .........360.........370.........380.........390.........400.........410.........420
Sequence YRSLRLADPLNNEIIKPSVNVSTKAELLLKALDHVFFRSKSGTKERATAFTKRLYMCISHTPEKTSIAIL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SS




S
TTTS

TTS
SSSTSS



TTTGGG

 .........430.........440.........450.
Sequence KFIDKLMNRYPEIAATLWDNALLEKHYCPVV
Predicted secondary structure










SS confidence






























Known secondary structure (DSSP)
S



SS
STTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D