Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em4n_

Fold library idPDB HeaderMoleculeTitle
c6em4n_4.10PDB header: ribosomeChain: N: PDB Molecule: 60s ribosomal protein l15-a;


Added to library: Sat Dec 30 08:28:01 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FITRSQAVRKLQVSLADFRRLCIFKGIYPRFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVSS
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
B
TS
T




B
SS
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence AKRLEENRDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPSTNQVSSKIINDAQKICNQWLAYVA
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T




SGGGTTTT

STTTT



SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KERLVRKVFVSIKGVYYQANIKGEEVRWLVPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT



SS
B
SSSS
B


B

SS




SS

TTTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LIYPPKLDLKKDKIISGLSSYILESRYDSPVASLFSAFVFYVSREVPIDILEFLILSCGGNVISEAAMDS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

SS



T
SSSSS






SSSTTTTTT



SSS
STTTT




STT


 .........290.........300.........310..
Sequence KVTHQIVDRPVLKNKVAGRTYIQPQWIFDCIN
Predicted secondary structure



















SS confidence































Known secondary structure (DSSP)





SS




SSS

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D