Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em4n_

Fold library idPDB HeaderMoleculeTitle
c6em4n_4.10PDB header: ribosomeChain: N: PDB Molecule: 60s ribosomal protein l15-a;


Added to library: Sat Dec 30 08:28:01 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FITRSQAVRKLQVSLADFRRLCIFKGIYPRFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVSS
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
B
TS
T




B
SS
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence AKRLEENRDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPSTNQVSSKIINDAQKICNQWLAYVA
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T




SGGGTTTT

STTTT



SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KERLVRKVFVSIKGVYYQANIKGEEVRWLVPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT



SS
B
SSSS
B


B

SS




SS

TTTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LIYPPKLDLKKDKIISGLSSYILESRYDSPVASLFSAFVFYVSREVPIDILEFLILSCGGNVISEAAMDS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

SS



T
SSSSS






SSSTTTTTT



SSS
STTTT




STT


 .........290.........300.........310..
Sequence KVTHQIVDRPVLKNKVAGRTYIQPQWIFDCIN
Predicted secondary structure



















SS confidence































Known secondary structure (DSSP)





SS




SSS

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D