Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em4A_

Fold library idPDB HeaderMoleculeTitle
c6em4A_4.10PDB header: ribosomeChain: A: PDB Molecule: ribosome biogenesis protein brx1;


Added to library: Sat Dec 30 08:34:22 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNKQRTLLISSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTLQQLNEIAELYNCNNVLFFEARKHQDLYLW
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)






BS



TT

B


B


TTT
S


STT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LSKPPNGPTIKFYIQGSRPVLSFDQRFESSPHYQLIKELLVHNFGVPPNARKSKPFIDHVMSFSIVDDKI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTT










STTSSSSSS

TT
TT

SS


TT
 .....
Sequence WVRTY
Predicted secondary structure

SS confidence




Known secondary structure (DSSP)





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D