Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em3K_

Fold library idPDB HeaderMoleculeTitle
c6em3K_3.20PDB header: ribosomeChain: K: PDB Molecule: proteasome-interacting protein cic1;


Added to library: Sat Dec 30 08:28:12 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AIPRERVIKAVNELIKFTSKPEEELKKDLQLIVVNNKSFTGTSKSFKLKLLNVKHSFYKPWKEASATAVK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)






TT
S
TTTT








SS
SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DFKVLLILKDSDIKKVSEDDLFDQLDSEGIKVDEIICGKDLKTVYKAYEARNAFISQFSLILADDSIVTS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)




TT

TTTT




TTSS
STT
STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LPKLMGGKAYNKVETTPISIRTHANKEFSLTTLTNNIKKVYMNQLPVKLPRGTTLNVHLGNLEWLRPEEF
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) STTGGGSSSSSS


BSSSSB





SSSSSSS
 .........220.........230.........240......
Sequence VDNVELISEQLIKAYQIRSIFIKTNRSPVLPLYYNQ
Predicted secondary structure











SS confidence



































Known secondary structure (DSSP) TTS


TTS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D