Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6em3D_

Fold library idPDB HeaderMoleculeTitle
c6em3D_3.20PDB header: ribosomeChain: D: PDB Molecule: atp-dependent rna helicase has1;


Added to library: Sat Dec 30 09:16:35 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GYVVCDSDKRFLLLFSFLKRNQKKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFC
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
BB


TTS

SS
S
TTTTTT



TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRGKSLMFLTPNPLNEYEFPENKIANVQS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T
SS
TTTTTT


SS


S

SSSTTTTTTT



B
S




B



GGGS


 .........150.........160.........170.........180.........190....
Sequence QLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQIDKLDLAKVAKSYGFPV
Predicted secondary structure









SS confidence





















































Known secondary structure (DSSP) TTT
SS
S
SSSSS
S
TT
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D