Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6elqA_

Fold library idPDB HeaderMoleculeTitle
c6elqA_2.52PDB header: oxidoreductaseChain: A: PDB Molecule: carbon monoxide dehydrogenase;


Added to library: Sat Jan 6 08:19:24 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKLSVDPVIPNLYRKAREEGISTVFDRYEAQQPQCGFGLTGLCCRHCVQGPCRIDPFGEGPQAGICGATA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

SBSSTTTT



S

T

SSTT



TTS
S

B
TT

B
 .........80.........90.........100.........110.........120.........130.........140
Sequence EVITARNLLRQVTAGAAAHVDHAYDVLEVLEQIAQGTESYSIKDQEKLKQVAFTLGIDTANKTEQEIVEE
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT
SS


S
TT


TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence MCQIIYRDFANSGATPMTYLKANSPRERLETWEKLGVLPRNPDREIREALHQTTMGMDADPVNLILKTIR
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT

SS


TTS
T


S
TSTTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence LGLVDGFAGLKLATDLQDIIFGTPQPVVTEANLGVLKEDYVNIIVHGHVPLLSEKIVEWSRKLEDEAKKA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT




SGGG

TTSSS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence GAKGINLAGICCTGNEVLMRQGVPLATNFLAQELAIITGAVDLMVVDVQCIMPSLAEIAACYHTRLVTTM
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T
S




STTTS

SSS

TTTSS

B
 .........360.........370.........380.........390.........400.........410.........420
Sequence PIVKIPGAEHVPFTTETADEASQQIVRMAIESYQKRNPAKVYIPREKAKVVAGFSVEAIVKALAKLNPDD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTB

TTS



STTTT

GGG









TT
SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence PLKPLIDNIVSGNILGVVATVGCNNVKVKHDWFHIELVKELIKNNVLVVTTGCSAHALAKAGLMDPAAAE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTSS





TTS
BTTT
TTTTSGGGGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence WAGEGLRAVLTAIGTANDLGGPLPPVLHMGSCVDNSRIGDLVIAVANYLKVSPKDLPIAASAPEYQHEKA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GS
GGGT

S


S

SSTTTTS
GGGSSTT

S
 .........570.........580.........590.........600.........610.........620.........630
Sequence LSIGTWAVAMGIMTHLGVVPPVVGSSKVTRILTQDAEALIGGKFYVETDPYKAAAGIIEHIKAKRALLNL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT

SS

TTTT
TS




T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D