Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ek4A_

Fold library idPDB HeaderMoleculeTitle
c6ek4A_2.80PDB header: membrane proteinChain: A: PDB Molecule: paxb;


Added to library: Sat May 19 08:33:58 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VVYPEINVKTLSQAVKNIWRLSHQQKSGIEIIQEKTLRISLYSRDLDEAARASVPQLQTVLRQLPPQDYF
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP)









S
STSTTST
 .........80.........90.........100.........110.........120.........130.........140
Sequence LTLTEIDTELEDPELDDETRNTLLEARSEHIRNLKKDVKGVIRSLRKEANLMASRIADVSNVVILERLES
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) SSSS

TTTTT



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence SLKEEQERKAEIQADIAQQEKNKAKLVVDRNKIIESQDVIRQYNLADMFKDYIPNISDLDKLDLANPKKE
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) TTS
SB


TTGGGGSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence LIKQAIKQGVEIAKKILGNISKGLKYIELADARAKLDERINQINKDCDDLKIQLKGVEQRIAGIEDVHQI
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) TT
SSS

B
 .........290.........300.........310.........320.........330.........340..
Sequence DKERTTLLLQAAKLEQAWNIFAKQLQNTIDGKIDQQDLTKIIHKQLDFLDDLALQYHSMLLS
Predicted secondary structure

SS confidence





























































Known secondary structure (DSSP) SS

T




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D