Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ejxD_

Fold library idPDB HeaderMoleculeTitle
c6ejxD_2.00PDB header: blood clottingChain: D: PDB Molecule: platelet glycoprotein ib alpha chain;


Added to library: Sat Oct 27 08:40:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SQHTCSISKVTSLLEVNCENKKLTALPADLPADTGILHLGENQLGTFSTASLVHFTHLTYLYLDRCELTS
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)


SS
SSSS
TTS

SS

S


TT

SS


GGGGTT
TT



SS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LQTNGKLIKLENLDLSHNNLKSLPSLGWALPALTTLDVSFNKLGSLSPGVLDGLSQLQELYLQNNDLKSL
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)

S

TT



SS

S




TTT
TT



SS





TTTTTT
TT



SS




 .........150.........160.........170.........180.........190.........200.........210
Sequence PPGLLLPTTKLKKLNLANNKLRELPSGLLDGLEDLDTLYLQRNWLRTIPKGFFGTLLLPFVFLHANSWYC
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
TTTTTT
TT



SS





TTTTTT
TT



SS





TTTTTT


S

SS
B

 .........220.........230.........240.........250.........260......
Sequence DCEILYFRHWLQENANNVYLWKQGVDVKDTTPNVASVRCANLDNAPVYSYPGKGCP
Predicted secondary structure





































SS confidence























































Known secondary structure (DSSP) SGGGTGGGB



TTS
GGGS


GGGSTTTTTGGG


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D