Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ejiA_

Fold library idPDB HeaderMoleculeTitle
c6ejiA_2.30PDB header: transferaseChain: A: PDB Molecule: wlac protein;


Added to library: Sat Feb 10 10:58:33 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XXXKISFIIATLNSGGAERVLVTLANALCKEHEVSIIKFHTGESFYKLENEVKVTSLEQFRFDTLYHKIA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


S

SSSTTTSSS



SS


TTS





SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SRFKKFFALRKALKESKADVFISFLDTTNIACILANIGLKTPLIISEHSNEAYLKPKTWRFLRRVSYPFC
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SSTTT

S


S
GGG


GGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DALSVLGSSDKVYYERFVKRVKLLLNPCHFSDEIPFDSSFEKENLVLFIGRLDHNKNPVXFLKAIAHLDK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSSTT
S





GGGGTS
TT





SS

STTT
TS
 .........220.........230.........240.........250.........260.........270.........280
Sequence NLQENYKFVIAGDGELRQELEYKVKSLGIKVDFLGRVENVKALYEKAKVLCLCSFVEGLPTVLIESLYFE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT



TTT


S
S

S

SB
SS
TGGGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VCRISSSYYNGAKDLIKDNHDGLLVGCDDEIALAKKLELVLNDENFRKELVNNAKQRCKDFEISNIKEEW
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


BTTGGGT

BTTTB
TT
T
GGGGGGG
 .........360
Sequence LKLIVEVKNA
Predicted secondary structure

SS confidence









Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D