Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ei9A_

Fold library idPDB HeaderMoleculeTitle
c6ei9A_2.55PDB header: flavoproteinChain: A: PDB Molecule: trna-dihydrouridine synthase b;


Added to library: Sat Jan 20 09:59:17 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PRGSMRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMGAGLTVSEMMDEPGIRTVQIAGSDPKEMADAARI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S
TTSSS


TTT

TT
S



SSS


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVDVPVTLKIRTGWAPEHRNCEEIA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT
S

TTTTGGGGGG
TT
SS
STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPVIANGDITDPLKARAVLDYTGADALMIGR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T


SS
GGGTT
S


S
SS
S


S

S
G
 .........220.........230.........240.........250.........260.........270.........280
Sequence AAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAHVRELHDFYGPAKGYRIARKHVSWYLQEHAPNDQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) GGSS
TTS






TT
SS
 .........290.........300......
Sequence FRRTFNAIEDASEQLEALEAYFENFA
Predicted secondary structure




SS confidence

























Known secondary structure (DSSP)


TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D