Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ei9A_

Fold library idPDB HeaderMoleculeTitle
c6ei9A_2.55PDB header: flavoproteinChain: A: PDB Molecule: trna-dihydrouridine synthase b;


Added to library: Sat Jan 20 09:59:17 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PRGSMRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMGAGLTVSEMMDEPGIRTVQIAGSDPKEMADAARI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S
TTSSS


TTT

TT
S



SSS


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVDVPVTLKIRTGWAPEHRNCEEIA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT
S

TTTTGGGGGG
TT
SS
STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPVIANGDITDPLKARAVLDYTGADALMIGR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T


SS
GGGTT
S


S
SS
S


S

S
G
 .........220.........230.........240.........250.........260.........270.........280
Sequence AAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAHVRELHDFYGPAKGYRIARKHVSWYLQEHAPNDQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) GGSS
TTS






TT
SS
 .........290.........300......
Sequence FRRTFNAIEDASEQLEALEAYFENFA
Predicted secondary structure




SS confidence

























Known secondary structure (DSSP)


TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D