Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6efnA_

Fold library idPDB HeaderMoleculeTitle
c6efnA_1.29PDB header: oxidoreductaseChain: A: PDB Molecule: sporulation killing factor maturation protein skfb;


Added to library: Sat Oct 27 08:35:41 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PELAVHLQPHGAVMIDRKSMFYFRLSGRGAQLAFLLSKNKNLHKTARIWEIMKKEEMSADQLKEELSAHP
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TTTTT









TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence FTEAWTEGLLDQPLHVSGSLDSYLPISCTLQLTNACNLSCSFCYASSGKPYPEELSSEQWILVMQKLAAH
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TTTTTT
S


SSS


S

SB
S


TT
TT

BS

SS


T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GVADITLTGGEAKLIKGFKELVVVASSLFTNVNVFSNGLNWRDEEVELLSHLGNVSVQISIDGMDNTHDQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T

SSSGGGSTTSS
S
S


S

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LRGRKGGFKESMNTIKKLSEANIPVIVAMTINESNADEVSDVVEQCANAGAFIFRAGKTLSVGRATEGFK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T
TTTT


TTTGGGT
S

SSGGGGTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence ALDIDFEEMVQIQLREARHKWGDRLNIIDWETDFCTPGYLAWYIRADGYVTPCQLEDLPLGHILEDSMAD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTTS








BTTT
TTSSSTT



STTTS
 .........360.........370.........380...
Sequence IGSPARLLQLKCEAKNCKCIGKIELSEPDLPFQ
Predicted secondary structure
















SS confidence
































Known secondary structure (DSSP) T

SS
SSGGG





B
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D