Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6deeA_

Fold library idPDB HeaderMoleculeTitle
c6deeA_3.04PDB header: endocytosisChain: A: PDB Molecule: nck-interacting protein with sh3 domain;


Added to library: Sat Oct 27 08:25:12 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VPRTIGAELMELVRRNTGLSHELCRVAIGIIVGHIQASVPASSPVMEQVLLSLVVCHDQQRLEVIFADLA
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)

TT


STT
T


T
 .........80.........90.........100.........110.........120.........130.........140
Sequence RSWALYEDEGVIRCYLEELLHILTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMC
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)

GGGGS
S
TTTTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence SLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TT
SS
TT
TSS




TTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence EDGLPTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDPVRIFKHEPQPP
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T





STTSS
SSSS







SS

S

SS


 .........290.........300.........310.........320.........330.........340.........350
Sequence HSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TTSTTS
S
TT
SSS

TT
 .........360.........370.........380..
Sequence DLQAILRRILNEEETSPQCQMDRMIVREMCKE
Predicted secondary structure








SS confidence































Known secondary structure (DSSP) T








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D