Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6d79A_

Fold library idPDB HeaderMoleculeTitle
c6d79A_3.50PDB header: transport proteinChain: A: PDB Molecule: sulfate transporter cysz;


Added to library: Sat May 19 08:33:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GPQYLREGLKLVLSPGLRLFVLLPLLINLVLFVGLIYFAGHQFSLWPLFVVLVALXVFFTFTXLANIIAA
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP)
TTT
TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence PFNGFLSEKVEAVVRGVDNSPPFSWGELIAXVPRTLAREXRKLGYFLPRAIALLILSFIPVLNLVAAPLW
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) SSS
SS



GGGGGGTTTSTTGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence LIFGVWXXAIQYIDYPADNHKLGWNEXLAWLREKRWQSLSFGGIVYLVLLIPVVNILXXPAAVAGATLFW
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TS


TTSTTT
 ...
Sequence VRE
Predicted secondary structure
SS confidence


Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D