Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6co7C_

Fold library idPDB HeaderMoleculeTitle
c6co7C_3.07PDB header: membrane proteinChain: C: PDB Molecule: predicted protein;


Added to library: Sat May 19 08:51:50 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FTPLYDGGDSSHVHLNKFSRRECIRFVPKCTTKHPTNAYGEIDFEGYGGQKRAPYLRMSHDTDANLVITL
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)






TTTSS

TT













S

SSSSSS

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence MLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTS




S


SS




T


BSST
 .........150.........160.........170.........180.........190.........200.........210
Sequence MFGSDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGV
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
SSS

TTT
S


SSS


S

SS

TT

S

B
TT
S
S
SS
STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence EIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTSSB


SSSSS

B




STTT

SSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AYNHTIKRNVDGQTINVIDPQYEDEVRAKVVEVFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDID
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SS



SS
TTTB




SSSSTS

TTTSBTTT
TTS
SS

 .........360.........370.........380.........390.........400.........410.........420
Sequence LAILKALLKANRSSPVAQLNLALAWNRIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNG
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) T
S
T
TS
SSS


TT
TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence LSMREFLSLDILCKLYAEVPGNTTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



T

SSSSTTT

S

TSTTT


TTTT
GGG

 .........500.........510.........520.........530.........540.........550.........560
Sequence IDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHAR
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)



S
TT
S
S

SSS


 .........570.........580.........590.........600.........610.........620.........630
Sequence LFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TB
BTTTTTB
TT
TSSTTS
TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence TRWWKVLVCLYLPVLIFPIIYFVPDEQHERQAAEREHQKSLNQDDSMEVIMRNKKLGFCDRIMHFYSAPF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


TTTTTTS


TS
S



S




SSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence SKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDK
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T





TTSGGGS

S
SSSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence VSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TSSTTT

TTTTSTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence QKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGEKP
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
SSSSS



TT


SS

T
 .........920.........930.........940.........950.........960.........970.........980
Sequence KEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFA
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTT



TTTTS
SS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence PPLVLLGHILIFIRWVWRTMKIGLSPAEMEQMDNWEFQAAEMYIHQQQQKNSGTLEERVRALGDRVDCIN
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTT



B


TS
 .........1060.
Sequence SQLNRVLDSMS
Predicted secondary structure

SS confidence










Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D