Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6cboB_

Fold library idPDB HeaderMoleculeTitle
c6cboB_1.60PDB header: transferaseChain: B: PDB Molecule: c-6' aminotransferase;


Added to library: Sat Feb 24 08:39:31 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GKLLAQEPTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT

S




B
TTS
B



BT
TTS
SST

S
BT
TTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence GTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDRSIVLSSGYHGYDPMWHCDEPFTP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTS



SSST

S


S
GGG

SSTTSB
 .........150.........160.........170.........180.........190.........200.........210
Sequence NQHGIVEFLFDLDVLAEWLSRPEQVAAVVISPDHMHLGERWYTEFTRLTKEADVPVIADEVKVGLRYRAG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTS
TT
TSGGG


SSS

T

TTTTTTSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LSTPLLDPAVWIVAKCLANGSPVAAVGGDAHLLAALEDVSFTSYFEPTAMAAATTTLRRMATGEPQQAIR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
S
TT


S
TTTSTTSS

TTTTGGGGG


TTTT
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFEGDNQTPSAAFTDEV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT

TTSSTT

TTS
B


TT

 .........360.........370.........380.........390.........400........
Sequence VEDACGRIDRVSAALTGRFTDRELTEESWYASAWGAMDGLADRPRTREETTAIVERLW
Predicted secondary structure



















SS confidence

























































Known secondary structure (DSSP) TTTSTT



SS

S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D