Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6cboB_

Fold library idPDB HeaderMoleculeTitle
c6cboB_1.60PDB header: transferaseChain: B: PDB Molecule: c-6' aminotransferase;


Added to library: Sat Feb 24 08:39:31 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GKLLAQEPTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT

S




B
TTS
B



BT
TTS
SST

S
BT
TTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence GTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDRSIVLSSGYHGYDPMWHCDEPFTP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTS



SSST

S


S
GGG

SSTTSB
 .........150.........160.........170.........180.........190.........200.........210
Sequence NQHGIVEFLFDLDVLAEWLSRPEQVAAVVISPDHMHLGERWYTEFTRLTKEADVPVIADEVKVGLRYRAG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTS
TT
TSGGG


SSS

T

TTTTTTSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LSTPLLDPAVWIVAKCLANGSPVAAVGGDAHLLAALEDVSFTSYFEPTAMAAATTTLRRMATGEPQQAIR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
S
TT


S
TTTSTTSS

TTTTGGGGG


TTTT
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFEGDNQTPSAAFTDEV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT

TTSSTT

TTS
B


TT

 .........360.........370.........380.........390.........400........
Sequence VEDACGRIDRVSAALTGRFTDRELTEESWYASAWGAMDGLADRPRTREETTAIVERLW
Predicted secondary structure



















SS confidence

























































Known secondary structure (DSSP) TTTSTT



SS

S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D