Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6cbnA_

Fold library idPDB HeaderMoleculeTitle
c6cbnA_1.35PDB header: transferaseChain: A: PDB Molecule: neamine transaminase neon;


Added to library: Sat Feb 24 08:37:11 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



S




B
TTS
B

BTTTS
SST
SS
BT
TTTT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence TGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLLLSAGYHGYDPMWYPSEAPLEP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TS


SSSST

S


S
GGG


SSTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTS
TT
TTSGGG


TTTS
T
TTTTTTSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LSTAELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEVSFTSFFEPTILAAADAALARVATGEPQRAV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTTTTT

S
TTSSTT
S

GGGGG


TTTT
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence REAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGVSAAFDEA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT


SSSSSTT

TTS
B


TT

 .........360.........370.........380.........390.........400.........
Sequence VLGEAERRFARVCERLAPYAGGEPVGDAARYRVAWNVMDGLRQAPRDREETTGLLARLL
Predicted secondary structure























SS confidence


























































Known secondary structure (DSSP) TGGGTT




SS








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D