Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6cbnA_

Fold library idPDB HeaderMoleculeTitle
c6cbnA_1.35PDB header: transferaseChain: A: PDB Molecule: neamine transaminase neon;


Added to library: Sat Feb 24 08:37:11 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



S




B
TTS
B

BTTTS
SST
SS
BT
TTTT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence TGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLLLSAGYHGYDPMWYPSEAPLEP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TS


SSSST

S


S
GGG


SSTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTS
TT
TTSGGG


TTTS
T
TTTTTTSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LSTAELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEVSFTSFFEPTILAAADAALARVATGEPQRAV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTTTTT

S
TTSSTT
S

GGGGG


TTTT
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence REAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGVSAAFDEA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT


SSSSSTT

TTS
B


TT

 .........360.........370.........380.........390.........400.........
Sequence VLGEAERRFARVCERLAPYAGGEPVGDAARYRVAWNVMDGLRQAPRDREETTGLLARLL
Predicted secondary structure























SS confidence


























































Known secondary structure (DSSP) TGGGTT




SS








Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D