Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c8zA_

Fold library idPDB HeaderMoleculeTitle
c6c8zA_2.86PDB header: transferaseChain: A: PDB Molecule: adp-dependent phosphofructokinase;


Added to library: Sat Feb 10 08:26:31 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDISEWEKRYNEAYSDISKSLKKVKGIFVAYNSNIDAIKHIDEDDIEKLLEQVDAKEVQERIMEYPRQID
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)


GGG


S



TTS
S

SSB
 .........80.........90.........100.........110.........120.........130.........140
Sequence SPADFVARLIISMRDGKAAEVPTYTTDIHEWLTDNLGFDEARMGGQAGIISNLLANMGIKNVIAYVPWLS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SS




ST

SSTT
S

TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence KEQAEYFVDSENLLHPVVENGKLELKHPKEAYNPDNKPKVNWIIEFSKGLEVKFAGEKIVVPRDNRLIVS
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TS


TT
SS

GGGS

TT




TT
TT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SRPPWIRIDMSEELYEHLPEIGKNIDGAILSGYQMIKEEYEDGKTYKDYVEKAVNVIKRLKEGNPDIRIH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

TT

S


TT
S

GGG

SB
TTS
B
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VEFTSIQNKLIRKAILKDIVRKHVHSLGLDTVEVANALNVLGYEELAYSVIKKDENAIVALYEGAVILLH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



S
TT
STT
S
SST
 .........360.........370.........380.........390.........400.........410.........420
Sequence ELKLERVHVHSLGYYICVVSKDSPVSPEDHRKSLLFASTVAAARALLGNINSLDDIEAGLDVPVSEQGYN
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT
S
SSTT
SS
SS

STTGGGGGGGS
B
 .........430.........440.........450.........460.........470.........480........
Sequence QLEKLEKYLVRRGICTLEDFENGCICTPNHDVIIIPTKVVEKPVATVGIGDTISAAAFVSVLAKMKKK
Predicted secondary structure

































SS confidence



































































Known secondary structure (DSSP) TTS

TTT
B

SS
S

SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D