Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c8zA_

Fold library idPDB HeaderMoleculeTitle
c6c8zA_2.86PDB header: transferaseChain: A: PDB Molecule: adp-dependent phosphofructokinase;


Added to library: Sat Feb 10 08:26:31 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDISEWEKRYNEAYSDISKSLKKVKGIFVAYNSNIDAIKHIDEDDIEKLLEQVDAKEVQERIMEYPRQID
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)


GGG


S



TTS
S

SSB
 .........80.........90.........100.........110.........120.........130.........140
Sequence SPADFVARLIISMRDGKAAEVPTYTTDIHEWLTDNLGFDEARMGGQAGIISNLLANMGIKNVIAYVPWLS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SS




ST

SSTT
S

TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence KEQAEYFVDSENLLHPVVENGKLELKHPKEAYNPDNKPKVNWIIEFSKGLEVKFAGEKIVVPRDNRLIVS
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TS


TT
SS

GGGS

TT




TT
TT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SRPPWIRIDMSEELYEHLPEIGKNIDGAILSGYQMIKEEYEDGKTYKDYVEKAVNVIKRLKEGNPDIRIH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

TT

S


TT
S

GGG

SB
TTS
B
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VEFTSIQNKLIRKAILKDIVRKHVHSLGLDTVEVANALNVLGYEELAYSVIKKDENAIVALYEGAVILLH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



S
TT
STT
S
SST
 .........360.........370.........380.........390.........400.........410.........420
Sequence ELKLERVHVHSLGYYICVVSKDSPVSPEDHRKSLLFASTVAAARALLGNINSLDDIEAGLDVPVSEQGYN
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT
S
SSTT
SS
SS

STTGGGGGGGS
B
 .........430.........440.........450.........460.........470.........480........
Sequence QLEKLEKYLVRRGICTLEDFENGCICTPNHDVIIIPTKVVEKPVATVGIGDTISAAAFVSVLAKMKKK
Predicted secondary structure

































SS confidence



































































Known secondary structure (DSSP) TTS

TTT
B

SS
S

SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D