Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c8vA_

Fold library idPDB HeaderMoleculeTitle
c6c8vA_3.20PDB header: oxidoreductaseChain: A: PDB Molecule: coenzyme pqq synthesis protein e;


Added to library: Sat Feb 17 08:32:17 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VIPAPVGLLAELTHRCRSAELDTQTWLRVLTEAAGLGVLHVHLSGGEPTARPDIVEITAKCAELGLYSNL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)














T

S
GGGSTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ITSGVGGALAKLDALYDVGLDHVQLSVQGAQPQKMQFAARVTELGLPLTLNSVIHRGNIHEVPGFIDLAV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


GGGTTTTT






TT



TTTGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence KLGAKRLEVAHTQYYGWAYVNRAALMPDKSQVDESIRIVEAARERLKGQLVIDLVVPDYYAKYPKACAGG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) T
SSSSSTTS


S
STTS

TTTT



SS
SS


GGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence WGRKLMNVTPQGKVLPCHAAETIPGLEFWYVTDHALGEIWTKSPAFAAYRGTSWMKEPCRSCDRREKDWG
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) TTSS
TTSSSTTGGGSTT


TTTS

TSSSTT

TTGGG
GGGGTTTT
 .........290.........300.........310..
Sequence GCRCQALALTGDAANTDPACSLSPLHAKMRDL
Predicted secondary structure
















SS confidence































Known secondary structure (DSSP) S
S
TTS

TTSTTSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D