Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c8rA_

Fold library idPDB HeaderMoleculeTitle
c6c8rA_1.95PDB header: transferaseChain: A: PDB Molecule: loganic acid o-methyltransferase;


Added to library: Sat Feb 10 08:29:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VEAHPMKGGDDSHSYSQNSCYQKGVIDAAKAVIVEAVNEKLDLENNPIFDPIKPFRIADFGCSTGPNTFH
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)







SSSTTSGGGS



TT
GGG
TTS
T
TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AMQNIVESVETKYKSLQKTPEFHVFFNDHVNNDFNVLFRSLPPNREFFAAGVPGSFYTRVFPKNSIHFAH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTT




TTS
TS
TT
SSS
TTS

S
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence CSYALHWLSKVPKEIQDKNSLAYNKGRIHYTGTEKHVVKAYFGQFQRDFEGFLKARAQEIVVGGLMVIQI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
TTB
SS

GGGG
TTSTT

TT
SS

S

 .........220.........230.........240.........250.........260.........270.........280
Sequence PGLPSGEVLFSRTGAGLLHFLLGTSLMELVNKGIINEESVDSFNLPQYHPSVEDLEMVIEMNDCFTIERV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
B
TT


GGGBTTSS
T



B


B
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GTLPHPMKNLPFDVQRTSLQVRAIMECILTEHFGENILDPLFEIYTKNLQENFHVFDKEIRKDADLYLVL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)


TTTTS



GGGTTSBS

 ........
Sequence KRKGNLEH
Predicted secondary structure





SS confidence







Known secondary structure (DSSP)

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D