Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c8rA_

Fold library idPDB HeaderMoleculeTitle
c6c8rA_1.95PDB header: transferaseChain: A: PDB Molecule: loganic acid o-methyltransferase;


Added to library: Sat Feb 10 08:29:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VEAHPMKGGDDSHSYSQNSCYQKGVIDAAKAVIVEAVNEKLDLENNPIFDPIKPFRIADFGCSTGPNTFH
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)







SSSTTSGGGS



TT
GGG
TTS
T
TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AMQNIVESVETKYKSLQKTPEFHVFFNDHVNNDFNVLFRSLPPNREFFAAGVPGSFYTRVFPKNSIHFAH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTT




TTS
TS
TT
SSS
TTS

S
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence CSYALHWLSKVPKEIQDKNSLAYNKGRIHYTGTEKHVVKAYFGQFQRDFEGFLKARAQEIVVGGLMVIQI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
TTB
SS

GGGG
TTSTT

TT
SS

S

 .........220.........230.........240.........250.........260.........270.........280
Sequence PGLPSGEVLFSRTGAGLLHFLLGTSLMELVNKGIINEESVDSFNLPQYHPSVEDLEMVIEMNDCFTIERV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
B
TT


GGGBTTSS
T



B


B
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GTLPHPMKNLPFDVQRTSLQVRAIMECILTEHFGENILDPLFEIYTKNLQENFHVFDKEIRKDADLYLVL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)


TTTTS



GGGTTSBS

 ........
Sequence KRKGNLEH
Predicted secondary structure





SS confidence







Known secondary structure (DSSP)

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D