Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c87A_

Fold library idPDB HeaderMoleculeTitle
c6c87A_2.60PDB header: protein transportChain: A: PDB Molecule: rab gdp dissociation inhibitor alpha;


Added to library: Sat Feb 17 08:26:09 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNEEYDVVVLGTGLTECVISGLLSVSGKKVLHMDRNPYYGGESASLNLDQMFEKFRGQDAKPPASLGRSR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


B
S

STT


SSSSSSGGG


SS



GGG

GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DYNIDLIPKFLMANGKLVKILRMTGVTRYNMEFALVEGSFVYHKGEIHKVPITPTEVAKTPLLGFFEKLK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) G

SS

BTTSTGGGSS



TT


STT
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence AKKLVSYLYDYDQNNPKTHQGFDCSKDTMDKIYKYYGVSEDTTDFLGHAVALYTDDSYMTTVPALEVIER
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

TT
GGGTTT

TTTSBT

TTS

SSTTSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence MRLYEDSLNMYGKSPYVYPMYGLGELPQVFARLCAVYGGTYMLDKKVDRIVYDDNGHVVGVESGGEVAKC
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS
STT
TTTT


S




TTS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KMVVGDPSYFPEKVRKTGKVIRVICILSHPVKSTENAKSSQIIFPQKQTGRKHDIYCCVTSFTHHVAPNG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
GGG
GGGSS

TTSTT
SS
TSSS
GGGTSS
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence KYIAIVSTTVESDNPENEVKVVLDLLNPIDEKFVYILDTYAPLEDGKKDGVFISKSYDATTHFESCAVDI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


SS
T
S
SSS
STTTS




S
SBS
 .........430.........440..
Sequence VDIYERITGEKFDWNKKPVEPQ
Predicted secondary structure














SS confidence





















Known secondary structure (DSSP) SS


TT







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D