Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c87A_

Fold library idPDB HeaderMoleculeTitle
c6c87A_2.60PDB header: protein transportChain: A: PDB Molecule: rab gdp dissociation inhibitor alpha;


Added to library: Sat Feb 17 08:26:09 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNEEYDVVVLGTGLTECVISGLLSVSGKKVLHMDRNPYYGGESASLNLDQMFEKFRGQDAKPPASLGRSR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


B
S

STT


SSSSSSGGG


SS



GGG

GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DYNIDLIPKFLMANGKLVKILRMTGVTRYNMEFALVEGSFVYHKGEIHKVPITPTEVAKTPLLGFFEKLK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) G

SS

BTTSTGGGSS



TT


STT
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence AKKLVSYLYDYDQNNPKTHQGFDCSKDTMDKIYKYYGVSEDTTDFLGHAVALYTDDSYMTTVPALEVIER
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

TT
GGGTTT

TTTSBT

TTS

SSTTSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence MRLYEDSLNMYGKSPYVYPMYGLGELPQVFARLCAVYGGTYMLDKKVDRIVYDDNGHVVGVESGGEVAKC
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS
STT
TTTT


S




TTS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KMVVGDPSYFPEKVRKTGKVIRVICILSHPVKSTENAKSSQIIFPQKQTGRKHDIYCCVTSFTHHVAPNG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
GGG
GGGSS

TTSTT
SS
TSSS
GGGTSS
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence KYIAIVSTTVESDNPENEVKVVLDLLNPIDEKFVYILDTYAPLEDGKKDGVFISKSYDATTHFESCAVDI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


SS
T
S
SSS
STTTS




S
SBS
 .........430.........440..
Sequence VDIYERITGEKFDWNKKPVEPQ
Predicted secondary structure














SS confidence





















Known secondary structure (DSSP) SS


TT







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D