Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c5cA_

Fold library idPDB HeaderMoleculeTitle
c6c5cA_1.85PDB header: lyaseChain: A: PDB Molecule: 3-dehydroquinate synthase;


Added to library: Sat Jan 27 08:28:31 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNAMSIEKVPILGKETIHVGYGIADHIVREVIANLASSTYVIVTDTNMARTPQYSKLTDDFKTNLSEKRP
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

GGG
TTSS
S

STS
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence ESRLLTYCVSPGENNKNRATKAAVEDFLLQQGCTRDTVILAVGGGVIGDMIGFVAATFMRGVRVVQVPTT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T


SGGGSSTT

TT
SGGG


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLAMVDSSVGGKTAIDTPLGKNFIGAFHQPEYVFCDVSFLETLPARQFINGMAEVVKTAAIWNEEEFTRL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTTSS
TT


SGGGGGGS

 .........220.........230.........240.........250.........260.........270.........280
Sequence ENFSKKFLSVVTSKKPDLQSIKAELVKTVLESVRVKAGVVSSDEAGLRNLLNFGHTIGHAIEAVLTPEAL
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TSSS

GGGGT


TTTTTTTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence HGECVSIGMIKEAELSRYLGILPPVAVARLSKCLVAYGLPVSIDDKEFLKKVGPKRHYVEIDILLKKMAI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT
S
TT

SSTT
GGGGGG

 .........360.........370.........380.....
Sequence DKKNDIRCVLLEKIGKCYQLKAHQVSKQDLSFVLT
Predicted secondary structure

















SS confidence


































Known secondary structure (DSSP) TS


TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D